CAZyme Information: SAPIO_CDS7785-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS7785-t41_1-p1
• CAZy Family: GH7
• CAZyme Description: GPI mannosyltransferase 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		64654.96	8.8185

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000110:3085021-3086968(+)

Full Sequence      

MASTKSSHSPRVGYSSGKVLGALILLRLVNVALTQTFFQPDEYFQCLEPAWQAAFGKDSG
AYITWLRSSLHPALFAAVYKLADLVGQYVVPGLRTTLLLWAPKVTQAVIAALGDWYTWRL
AKRLYRDDTAASTAAWYVSVRTFSNSLETTLTIAALNYWPWDLFQPPVKEKIRSFGSMIR
SPEGLRSLRLSLVLAATAVLLRPTNMFIWAPVFIFTLIPNRLSPLLTHPTLKETVLFIRE
VVVYGVLTLAASLAADRLYFGFWTFPPYKWLYFNLSQSLAIFYGENPGHYYLTQGLPLLC
TTLLPFVLLALWRSDPDPAVSQAFKVFRWAVYLTITILSQVSHKEARFIYPLLPLLHILA
AKHVSHFFLWSPSHPSMPSQLHHKGYLAAGLLINLLLASYLSVAHQRAVISVLDFLRDQY
ATGDISTAPMTFGDNKPYVYFLTPCHSTPWRSHLIHPNLSVGALTCDPPLHTAPGTMERA
LYRDMADRFYDSPIGFLSHELWPVEAPSEDKAGAVGVPHFIVGFEGIEPVITEFFDGPGR
EHGVELKRVWEGWNGFFSEDWRRSGKLIVWETGV

Enzyme Prediction     

No EC number prediction in SAPIO_CDS7785-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	22	454	2.3e-92	0.987146529562982

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	4.65e-53	22	454	5	413	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	3.23e-48	26	498	48	485	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB87087.1|GT22	1.15e-187	8	574	28	632
CDP32608.1|GT22	6.36e-187	19	574	39	631
CAP69128.1|GT22	6.36e-187	19	574	39	631
UQC77542.1|GT22	9.61e-184	1	574	1	665
UNI21388.1|GT22	9.99e-182	23	574	20	598

PDB Hits     

SAPIO_CDS7785-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4IB63|GPI10_GIBZE	5.10e-172	3	574	7	603	GPI mannosyltransferase 3 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI10 PE=3 SV=1
sp|Q4WPG0|GPI10_ASPFU	9.59e-113	19	570	54	645	GPI mannosyltransferase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi10 PE=3 SV=1
sp|Q2UH15|GPI10_ASPOR	2.57e-98	23	570	61	627	GPI mannosyltransferase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi10 PE=3 SV=1
sp|Q5BCB9|GPI10_EMENI	1.84e-95	16	570	49	565	GPI mannosyltransferase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi10 PE=3 SV=1
sp|Q6CAB8|GPI10_YARLI	1.62e-80	19	569	18	507	GPI mannosyltransferase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.264933	0.735040	CS pos: 34-35. Pr: 0.7060

TMHMM  Annotations     

Start	End
198	220
241	263
290	312
348	370
385	404