CAZyme Information: SAPIO_CDS7606-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS7606-t41_1-p1
• CAZy Family: GH7
• CAZyme Description: GPI mannosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	JOWA01000110|CGC5	47679.24	9.9080

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000110:2420460-2421850(-)

Full Sequence      

MSLLTLISRPGPLFTLALLLRLTLFFYGLFQDAHSPVKYTDIDYLVFTDASRFVANHSSP
YDRETYRYTPLLAWLLLPTATWFFSFGKLVFAAADLLAGWLLARILIDGSPRMEAGRAYR
FAAIWLLNPMVATISTRGSSEGLLGVLTAALLWAVCKRRVVLAAVVLGVGVHFKIYPFIY
APASVWWMDDERMGRAVPNRAGQSLFMRILHFINPDRVKFAIISFATFMGLNFLMYSMYG
TPFIIHTYLHHVSRIDHRHNFSPYNILLYLSSSRPASSTPNPLAIESLAFLPQLLLSAVL
IPLVVAKQNLATSMMAQTFAFVTFNKVCTSQYFLWYLIFLPLYLPSSTFLSTPSLGLSAL
AAWILPQAIWLQQAYQLEFLGLPTFTPGLWGASLAFFLVNCWILGIVIWDGAVGPNTAGQ
RIKKA

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	134	408	7.4e-94	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	8.60e-77	27	408	25	415	GPI mannosyltransferase
252941	Mannosyl_trans	7.24e-67	134	408	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	5.25e-04	55	235	45	227	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK97783.1|GT50	1.69e-204	9	423	9	420
QKD53244.1|GT50	1.19e-194	9	412	9	409
CCT64532.1|GT50	1.60e-192	9	412	9	409
QGI60860.1|GT50	1.60e-192	9	412	9	409
QGI91761.1|GT50	1.60e-192	9	412	9	409

PDB Hits     

SAPIO_CDS7606-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	4.42e-190	9	412	9	409	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	4.59e-174	5	411	21	485	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	7.88e-165	5	413	3	412	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	9.07e-164	8	410	6	420	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	5.54e-162	5	421	3	439	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000009

TMHMM  Annotations     

Start	End
13	30
71	93
133	155
160	182
222	244
283	305
320	342
349	371
386	408