CAZyme Information: SAPIO_CDS7415-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS7415-t41_1-p1
• CAZy Family: GH6
• CAZyme Description: 1-alkyl-2-acetylglycerophosphocholine esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		34758.65	4.6992

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000110:1735878-1738031(-)

Full Sequence      

MEVPTPDTQEWDLQFPETDELQKLLHRAGSSTPLTLMDDAGGHADTGLELLQNMCLPPVN
EAQESGSPGQDKPLHAMEEDGLLSCPDSSPERGPNSILHLAVQSRRPASVTLLLRYGFDI
DARNTQGRTPLLIAIENDDHETVKTLLAHGADPNTASQRPNFEEESRRKANKTTHKISKI
KMKFTLGILFLALGYAHYVFDSLVLHGQPTTQWGYVRITENHYSNAPVVDVTSPEIRCYQ
ATDDGSSTEIANVTAGDTVGFTSSPAAYHPGPLSFYMAKAPDGVSAAEFNGTGNVWFKIS
QDKPAITASSITWPNTGEE

Enzyme Prediction     

EC	1.14.99.54:2	1.14.99.56:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA9	190	315	1.6e-28	0.5863636363636363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
410622	LPMO_AA9	4.91e-31	197	313	1	117	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 9 (AA9). AA9 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs) involved in the cleavage of cellulose chains with oxidation of carbons C1 and/or C4 and C6. Activities include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54) and lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56). The family used to be called GH61 because weak endoglucanase activity had been demonstrated in some family members.
397484	Glyco_hydro_61	2.10e-25	198	314	1	122	Glycosyl hydrolase family 61. Although weak endoglucanase activity has been demonstrated in several members of this family, they lack the clustered conserved catalytic acidic amino acids present in most glycoside hydrolases. Many members of this family lack measurable cellulase activity on their own, but enhance the activity of other cellulolytic enzymes. They are therefore unlikely to be true glycoside hydrolases. The subsrate-binding surface of this family is a flat Ig-like fold.
293786	ANK	1.15e-14	98	154	6	62	ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.
293786	ANK	5.11e-14	98	154	39	95	ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.
403870	Ank_2	1.42e-10	98	149	1	52	Ankyrin repeats (3 copies).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDV60872.1|AA9	9.61e-40	187	317	7	137
CAG27576.1|AA9	5.74e-39	182	318	1	140
AEO67662.1|AA9	5.74e-39	182	318	1	140
UQC88883.1|AA9	4.41e-37	182	318	1	138
ANB32141.1|AA9|1.14.99.54|1.14.99.56	2.31e-35	197	317	1	121

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B5Q_A	1.46e-27	197	319	1	125	Chain A, GLYCOSIDE HYDROLASE FAMILY 61 PROTEIN D [Phanerodontia chrysosporium],4B5Q_B Chain B, GLYCOSIDE HYDROLASE FAMILY 61 PROTEIN D [Phanerodontia chrysosporium]
3EII_A	1.64e-27	213	318	13	116	Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_B Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_C Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_D Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_A Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_B Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_C Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_D Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris]
4QI8_A	1.46e-24	197	318	1	120	Lytic polysaccharide monooxygenase 9F from Neurospora crassa, NcLPMO9F [Neurospora crassa],4QI8_B Lytic polysaccharide monooxygenase 9F from Neurospora crassa, NcLPMO9F [Neurospora crassa]
7EXK_A	5.89e-23	197	315	1	120	Chain A, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_B Chain B, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_C Chain C, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_D Chain D, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_E Chain E, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_F Chain F, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B]
5DNC_A	7.03e-06	69	151	433	512	Crystal structure of the Asn-bound guinea pig L-asparaginase 1 catalytic domain active site mutant T19A [Cavia porcellus],5DNC_B Crystal structure of the Asn-bound guinea pig L-asparaginase 1 catalytic domain active site mutant T19A [Cavia porcellus],5DNC_C Crystal structure of the Asn-bound guinea pig L-asparaginase 1 catalytic domain active site mutant T19A [Cavia porcellus],5DNC_D Crystal structure of the Asn-bound guinea pig L-asparaginase 1 catalytic domain active site mutant T19A [Cavia porcellus]

Swiss-Prot Hits     

SAPIO_CDS7415-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS7415-t41_1-p1.