CAZyme Information: SAPIO_CDS6649-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS6649-t41_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		35716.78	6.6129

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000106:75655-77293(+)

Full Sequence      

MIITQRRAWRLLALLTVILAAATFIFTFVPRVLAFAQLFGVFGEHSGTKITQVEIATRGA
DGREPVVPRILHQIFHNWRDPNDDRLPEDWEEAHQTCVLLNPEWEHKLWTSRNSRKFIEE
QYPWFLPTYDGYRYPIQRVDALKYFILRHYGGIYIDLDNGCAESLDPLRYYPAFTTDGGM
GALSNNILGGQPEHPWFHLLTNNLIPYDWNWLLPYVVVMYCTGQWYVTAIFEKYHSLLAA
DGTVRGFDGVGWAPLHHILMDGRPGADPWVFFTQSSLPVLLCKRTWEGRDAQLVPPGLLH
SHPQSPSTHS

Enzyme Prediction     

No EC number prediction in SAPIO_CDS6649-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	89	169	3e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.99e-35	64	245	79	254	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	9.11e-21	87	174	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ58620.1|GT32	4.83e-128	5	295	4	298
QGA12364.1|GT32	2.19e-120	31	276	29	280
QBZ63730.1|GT32	5.78e-105	29	276	423	688
AEO56548.1|GT32	2.44e-103	29	276	24	279
AEO62991.1|GT32	1.37e-93	41	272	38	280

PDB Hits     

SAPIO_CDS6649-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	1.85e-50	60	245	48	228	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.33e-48	66	245	61	236	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.47e-48	64	238	79	247	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.19e-43	67	241	57	225	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	9.47e-32	60	271	57	269	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999995	0.000036

TMHMM  Annotations     

Start	End
12	34