CAZyme Information: SAPIO_CDS6503-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS6503-t41_1-p1
• CAZy Family: GH45
• CAZyme Description: Gmc oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		68001.27	4.2551

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000104:58550-60723(+)

Full Sequence      

MKAASHFFFLCAAVSGALIPRHSTIVSRDIDLESEYDFVIAGGGISGLTVADRLTEDPNV
KVLVIEAGPFDLGEDSVLIPGAFNPVPYLWIPLLSVPQEALNNRSFNVPLGRVVGGGSVV
NAMVFARAGKGEYHDWEELGATGWDWDDLLPENFTAPDDEYAATANISWVDSVHGNEGPV
QCSYPNFFFEGSENWWNAALSAGLTTAGDPNGGNVAGLTWFPTVADFTTRTRSHARLNHY
DRVEDVRPNYHILPEHTVSRVIFNGTRAIGVEYLPSKGGDVATVTASREVHLAAGAVHTP
QILQLSGIGPRRLLEEFEIEIIADLPGVGQNFHDQPSIIIPYRVTNNIEPNMATLNTDEE
YDAEQRALYDASREGPYVLTRGLSTTLALPPLSNVTSSWRDIIEEAQGRDPADFLPDDVD
ESVLSGYKLQREITLRQLGGQETPVSMMHWDTADSVRMYFLRPLSRGSIRINTTNPLDNP
LIDFRTLTDPTDFDLVVASFLKNRDIMSQPTMAILGPEEQAPFGNNITDVDELKEILKSV
VEPSSAHECCTAAMMPKERGGVVNPQMRVYDVEGLRVIDVSYWPMVLTAAPTATTYASGE
KIADLIKLEYCLAGACDEED

Enzyme Prediction     

No EC number prediction in SAPIO_CDS6503-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	35	607	6.8e-162	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.51e-69	33	607	3	532	choline dehydrogenase; Validated
225186	BetA	4.96e-66	31	607	3	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.17e-42	37	587	2	467	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.02e-25	463	584	1	125	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.37e-22	121	336	34	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB74103.1|AA3_2	1.68e-258	8	612	43	630
CDP24859.1|AA3_2	6.97e-254	8	608	43	643
AEO67797.1|AA3_2	4.22e-234	8	616	18	642
CDP29496.1|AA3_2	8.67e-209	19	613	30	644
VBB81292.1|AA3_2	8.67e-209	19	613	30	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	2.00e-226	31	615	1	591	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	1.40e-98	11	610	11	642	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6XUT_A	1.36e-59	36	607	17	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
4YNT_A	2.79e-53	36	607	6	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	5.67e-51	10	610	13	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	9.13e-198	10	610	15	617	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.73e-73	37	607	41	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	6.31e-61	21	606	33	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	6.31e-61	21	606	33	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|P0DO29|ERIK_HERER	8.33e-60	34	607	32	596	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.631285	0.368721

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS6503-t41_1-p1.