CAZyme Information: SAPIO_CDS6484-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS6484-t41_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770		84799.58	5.8187

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000103:313721-316560(+)

Full Sequence      

MFYSRNPIPNSSSTSKASVDITATFFGHCVLMTFSLKVAARSFAMSTLNRTLSLLSLLSY
NPFIVEASIAAQRTFEERPELAPWQTWGPYRPNLYFGVRPLVPETFLMGLMWASGETRDA
MLKTLRDTCEQNDGMQGYGWTAYDTRIGGSQTIHDQELHVDLTTDFFKSEGGDAWAVRVT
GTPRSGAPSDVKTTIVMHVATEKAAGNNGTDRSLACKHKDQRSKRNGNNTEATCHGEAPA
VFTDQVKASDWDGVAVDDEPGVGNMHFVQSTFQGPFTVTFAYHSSEATPLTPDDIVTGLD
GFFSGFPAAVERVFPSAAPFESKEYGEFSQALISNLLGGLGFFHGDSKVDYTRAPEYEEV
GPNFWEKAAAARARTTITTTPPTSLLSHTPSRPFFPRGFLWDEGFHLLPVVEWDLDLAVS
VLRSWLNLMDEDGWIGREQILGPEARSRVPEEFQAHGHPSEPISSPDAGSNMLRELYPLI
SRHSAWFRRIRAGNFSSPCPRPEGAIEGEGYRWHGRSPMHTLTSGLDDYPRENPPHPGKL
HVDALGWVGASARALQLVAEHLGEDDDAATYEKHVDAVNDNGFKRVCHHGYISLFSLLLG
PMDAKHPNLPPLLDLLTNSILGDLSQGVLYNILAYPSLANPDIPDILYAEFGVTFVTATA
MILAGTMMERGRLLPSTLFILILRWTTFAYYLLAWPTGPRTLRVIKLLHQYGADIDAADV
NGDPLIVHAITKKDRDVVQLLESLGACVDASSGTQARAKTTPRKRPTSSF

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	5.17e-90	290	605	1	364	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.13e-51	87	202	3	120	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
293786	ANK	2.99e-04	702	750	48	96	ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.
372654	Ank_4	4.16e-04	702	741	14	53	Ankyrin repeats (many copies).
293786	ANK	4.96e-04	702	762	15	71	ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO69881.1|GH63	3.88e-223	73	618	31	674
KAF2823603.1|GH63	1.99e-213	84	618	42	656
KAF2201713.1|GH63	7.17e-185	55	618	1	650
KAF2471559.1|GH63	6.15e-147	87	619	36	667
KAF2710732.1|GH63	4.46e-143	87	618	39	683

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MHF_A	5.91e-74	79	619	31	661	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
4J5T_A	4.77e-67	87	618	17	686	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	9.57e-96	87	616	44	691	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|Q80UM7|MOGS_MOUSE	1.65e-74	79	619	86	716	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	6.40e-70	79	619	86	716	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	2.78e-67	79	619	88	719	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|P53008|CWH41_YEAST	3.31e-66	87	618	47	716	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999413	0.000592

TMHMM  Annotations     

Start	End
646	668
673	695