CAZyme Information: SAPIO_CDS6340-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS6340-t41_1-p1
• CAZy Family: GH38
• CAZyme Description: putative Glycosyl hydrolases family 35

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564		62291.05	5.0145

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000102:186174-187929(+)

Full Sequence      

MSAITIPHLVATETSKQLVVHGKPFLMLPAELQNSSMTCAEHMSTVWQNLVDANVNTVLG
SVTWEMIEPVEGLYNFEELDKVIFDARRHNLHLVLLWFGSYKNGVSTYVPPWVKTDVKRF
PRAKLRTKENTLRTSEVLSLFSSEAVTADAKAFKKLMSHVREIDEAHSTVLMVQVENEPG
LIGDSRDASAAATQRFSEPVPDDLIEYLSSEYDNLHDDLKENLAHFSARTADSGNASWED
VFGKGPKTDEIFMAYHYSRFVEKVAAAGREAYALPLFTNVWLNSSGNDADNDFPNVASGG
GDPGNYPSGGATSCALDIWQKFAPTLDFISPDIYLNDYSSICTKYRHRQQPLFIPEQRRD
AYGARRIWHALGSHAALGASPFGLDTVAPESNPYTRHFGLLESVSAIVLDAQRRPNSSVG
FFFDEIAEDGSDPSSPVVCRLGDYELTIGRCFVFGRPGPGSGMVIHRGGGVFLLIGWGFQ
VVARSLNPNATYTGILRFEEKFVVDSAAGKLRTGRYLNGDETRSGLFAMMPNEDPDYGGF
PVAVTIPAKTMIAELEVYHLTEDT

Enzyme Prediction     

No EC number prediction in SAPIO_CDS6340-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	18	199	1.4e-28	0.5439739413680782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407954	DUF5597	5.07e-32	394	529	1	130	Domain of unknown function (DUF5597). This is the C-terminal domain of xyloglucan utilization locus (XyGUL) present in Cellvibrio japonicas. XyGUL is required for xyloglucan utilization. It is also the C-terminal domain of PF02449 and PF01301.
224786	GanA	6.57e-09	38	366	93	402	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
396834	Glyco_hydro_42	1.05e-07	53	334	22	262	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
396048	Glyco_hydro_35	1.30e-04	17	207	1	178	Glycosyl hydrolases family 35.
226217	XynA	6.77e-04	64	129	69	129	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD85203.1|GH35	6.22e-285	5	564	7	564
UPK91263.1|GH35	8.69e-282	1	562	1	563
BCS30127.1|GH35	1.88e-281	6	562	8	562
QMW28948.1|GH35	7.82e-277	5	564	7	557
QMW41023.1|GH35	7.82e-277	5	564	7	557

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3U7V_A	9.97e-65	7	385	40	378	The structure of a putative Beta-galactosidase from Caulobacter crescentus CB15. [Caulobacter vibrioides NA1000]
7KMN_A	3.55e-64	1	531	21	523	Chain A, Beta-galactosidase, GH35 family [Xanthomonas citri pv. citri str. 306],7KMO_A Chain A, Beta-galactosidase, GH35 [Xanthomonas citri pv. citri str. 306]
4D1I_A	1.53e-63	3	385	1	342	The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_B The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_C The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_D The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_E The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_F The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_G The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_H The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1J_A The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_B The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_C The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_D The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_E The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_F The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_G The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_H The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107]
5JAW_A	1.89e-63	3	385	11	352	Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_B Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_C Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_D Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_E Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_F Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_G Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_H Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],6TBF_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBI_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBJ_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107]

Swiss-Prot Hits     

SAPIO_CDS6340-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000046

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS6340-t41_1-p1.