CAZyme Information: SAPIO_CDS6337-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS6337-t41_1-p1
• CAZy Family: GH37
• CAZyme Description: Glycosyl hydrolase family 10

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		40672.03	6.9449

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000102:175558-176756(-)

Full Sequence      

MRFSLITTALLACTFDTASAQLDFWAKKAGLKYFGSATDNPGMRERAGWEKKYPKYNAIF
ANKKEFSSTTPTNGMKWSILEETEGTLNFTEGDWLAQLAEKQGKSLRCHTLVYWGSFPRW
AYSKPWTKESLTQVITDHITKVVSHYKGKCYAWDVANEALNDDGTYHDGYFLYKVLGEEW
IKLAFRVAHQVDPHAKLYYNDVGIETPGPKADGVLRIIRMLQDEGIRIDGIGLQSHIVTG
KAASLDEYISAINAYGNLGMEVALTELDVGINPPVTEKALAQQKRDYNTIVGACVQASAC
IGVTLWDFYDPFSWLDYYSNTTQGTLWFENFKRHPAYDGVIDALKNGTCSGPRGHRWATC
KG

Enzyme Prediction     

EC	3.2.1.8:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	27	343	2.5e-85	0.976897689768977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	6.35e-109	26	342	5	310	Glycosyl hydrolase family 10.
214750	Glyco_10	1.46e-95	75	340	1	263	Glycosyl hydrolase family 10.
226217	XynA	1.65e-70	63	344	55	341	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC74857.1|GH10	8.81e-141	1	356	1	356
ASL68670.1|GH10|3.2.1.8	2.43e-140	1	348	1	349
QRI93685.1|GH10	7.98e-135	17	353	34	373
AHE13927.1|GH10	3.88e-133	22	351	28	357
AGG68962.1|GH10|3.2.1.8	6.52e-133	16	348	28	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	1.52e-95	20	344	1	317	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	7.41e-93	6	344	7	339	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3U7B_A	1.30e-76	18	344	1	324	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
4F8X_A	7.39e-75	21	350	3	333	Penicillium canescens endo-1,4-beta-xylanase XylE [Penicillium canescens]
3WUF_A	2.14e-74	32	344	14	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	1.39e-92	4	350	2	340	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|P79046|XYN1_HUMGT	6.03e-85	4	344	5	337	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|O60206|XLNA_AGABI	3.47e-83	10	342	7	329	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|G4MLU0|XYN5_MAGO7	5.99e-82	16	352	32	361	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|Q8J1Y4|XYN5_MAGGR	5.99e-82	16	352	32	361	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000485	0.999476	CS pos: 20-21. Pr: 0.9670

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS6337-t41_1-p1.