CAZyme Information: SAPIO_CDS6279-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS6279-t41_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	JOWA01000101|CGC1	36582.50	4.1521

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000101:344787-346093(-)

Full Sequence      

MKVSPIVGALSLAAGAMASKCASRNWSGWENAKHAFIFGDSYTQTGFEVNGTAPSASNPL
GNPPYPGWTSSNGPNWVGFLTTKYNATSSLRTYNLAYGGATVDSALVEPWKPTVLSLRDQ
VTDLFLANYAQDATDSQVSWDAKSTVFAVWIGINDVGNSYYNGVEATTELYWKIFDVYSS
LVEDLYGAGARNFVFLNVPPVQRSPLILAQGEEAAALETEALERFNALIEGLAGDLKKKH
EREVNVWVYDSYKSFGEVLDDVEAYPQTAGYKDTTTFCEAYQNGTPEWDTFDENCTYPVN
EYFWLNSLHPTYPIHDVVAEGVAELLSGPPNVGA

Enzyme Prediction     

No EC number prediction in SAPIO_CDS6279-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	37	322	5.9e-78	0.9850187265917603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.08e-61	36	324	3	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	2.55e-20	36	311	4	300	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	1.18e-13	38	329	35	336	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
395531	Lipase_GDSL	1.44e-08	36	273	2	208	GDSL-like Lipase/Acylhydrolase.
238883	Triacylglycerol_lipase_like	1.44e-07	36	311	5	266	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ46260.1|CE16	3.15e-110	22	332	34	340
QRC99106.1|CE16	2.82e-109	10	327	9	322
UJO22905.1|CE16	4.34e-109	23	327	31	329
CBY01773.1|CE16	5.21e-109	20	331	24	330
APA06788.1|CE16	1.09e-105	22	332	34	340

PDB Hits     

SAPIO_CDS6279-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	2.24e-59	31	328	30	299	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	6.98e-58	31	328	30	299	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000326	0.999627	CS pos: 18-19. Pr: 0.9558

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS6279-t41_1-p1.