CAZyme Information: SAPIO_CDS6219-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS6219-t41_1-p1
• CAZy Family: GH31
• CAZyme Description: FAD binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		63091.19	6.2985

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000101:158428-160369(-)

Full Sequence      

MLRTFLLDSLLLIGTVIGASPHNQWAKFNNSISGNLLAVQPVGLPCHDPTFDAEACLAVA
NQTTNSVWRGINPGAVQNVNWEALVAANETCYVGSSRTIACGQGRVPLYSAEVENAQHIQ
KAVRFAKKHNIRLAIKNTGHCYLGRSSAPYSLRIATHKLKSLDFVTDFAPTVPAGYKAQK
RKVQSLGSAVTIGAGVYLMDLYKAVGERNLTVVAGIAHTVGPAGGYIQGGGHSPLGTWKG
MASDNALQFTVVNADGDLVVANEYQNQDLFWALRGGGGGTFGVVVDVTVRTFPDVPAHLA
SVVVSTNNTAGFWETIREFHTNLPQINDAGASAYYFINTAPDGGNGSASISNLTSAMIFA
NQTDEAAVRSLLMPMVTNMNGHVGNSSVVFELVSVPQIKFIIQQFLSDGADVTGGIALLA
SRLISRDFLSTVDGPARLTETLRKIVDLHGGPTSVIGHAIAGGQVARNADIDSALLPAWR
RALTHIVVASSWGFNATIEDQRAVENQVTHTDVPMLKAFEPDDMGAYLNEADGNEEDWQA
SFWGENYHRLYELKQKLDPSGLFITRRGVGSEDWDEEGICRIGKERVG

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	111	324	2.5e-46	0.42358078602620086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.61e-14	107	262	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	5.18e-11	526	563	1	38	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
223354	GlcD	5.87e-11	105	563	30	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.00e-49	17	575	502	1055
QKD57322.1|CBM91|GH43_11	1.00e-49	17	575	502	1055
QRC92907.1|AA7	6.26e-16	105	571	58	492
AEO56694.1|AA7	4.54e-14	107	569	73	497
UNI23960.1|AA7	7.24e-14	107	293	48	216

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	1.53e-81	24	582	42	571	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	4.75e-53	21	581	40	597	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
4DNS_A	9.55e-19	107	328	55	260	Crystal structure of Bermuda grass isoallergen BG60 provides insight into the various cross-allergenicity of the pollen group 4 allergens [Cynodon dactylon],4DNS_B Crystal structure of Bermuda grass isoallergen BG60 provides insight into the various cross-allergenicity of the pollen group 4 allergens [Cynodon dactylon]
6JQH_A	5.75e-18	115	322	62	240	Chain A, MaDA [Morus alba],6JQH_B Chain B, MaDA [Morus alba]
4PVK_A	9.48e-18	107	326	53	256	Phl p 4 I153V N158H variant, a glucose oxidase [Phleum pratense],4PWC_A Phl p 4 I153V N158H variant, a glucose oxidase, 3.5 M NaBr soak [Phleum pratense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AS41|A7056_ARTBC	7.67e-177	25	581	41	587	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07056 PE=1 SV=2
sp|L0E159|MALF_MALAU	4.90e-127	24	580	39	576	FAD-linked oxidoreductase malF OS=Malbranchea aurantiaca OX=78605 GN=malF PE=1 SV=1
sp|E1ACP9|NOTD_ASPSM	1.04e-124	24	582	45	589	FAD-linked oxidoreductase notD OS=Aspergillus sp. (strain MF297-2) OX=877550 GN=notD PE=1 SV=1
sp|L7WR40|NOTD_ASPVE	3.49e-120	24	582	45	581	FAD-linked oxidoreductase notD' OS=Aspergillus versicolor OX=46472 GN=notD' PE=1 SV=1
sp|A2TBU3|EASE_EPIFI	1.25e-118	23	587	40	588	FAD-linked oxidoreductase easE OS=Epichloe festucae var. lolii OX=73839 GN=easE PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999747	CS pos: 18-19. Pr: 0.9814

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS6219-t41_1-p1.