CAZyme Information: SAPIO_CDS5997-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS5997-t41_1-p1
• CAZy Family: GH3
• CAZyme Description: Uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712	JOWA01000099|CGC5	77753.47	9.9040

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000099:2104810-2107157(+)

Full Sequence      

MPYIPPSKSAASSPPHGSPNATRRHSEPTLGAALPRSSSYLTKHRRTPSALGLSGQANGG
PNNPTPPGTSEDLKSLARGIGSIRQSPPPVTGPRGMPSGAVISPPDSLSGSDDEGLEMRG
RKLTNLKALKDAVNSIPLRRESSPVDEPSPVTPTVTELLSQPVTFVEGMHHSYSTGALDA
LGSRRTSRAVPGMECSAIHSSGSLTPSEEDSEDEKRAKPPMVRKKSGELVRPALRPPSRR
RPSSMPGTPTFSKAVHFDAHLEHVRHFLQVDRPLAVSAGSSPIDHLDSDSEYPFPPSDDE
HPRQPRSPPFEWEIITSNFPTDDLARNALPARVERLWLSKDCRSLHGSISVANLAFHKNV
ICRFTLDYWKTTSEVSAEYSGAIHSTGHDRWTFSIRLADMANLETKTLYLCIRYNVNGQE
YWDNNNGANFQVDFHKKYLPQNGKRGFLGAGTRPAGELPRSSRRPDANIQQPRPKSMPVG
LSSHLIDQARRTLDKSRDEFLDDHGPIRLKKSSSDFQDSSSSSRSSNAFGRRYDFNASLN
EAKQSAKTKDSRKLVNQPAVPSTLSTKPPPLLHSENHDSPKKKDYTYDEIVNRFCFYGSK
QAQTASQPKAPKASAGRLSGSADASEHYHHVSATPERRAGPRDANHTNTAVLALSTSPRS
DFSPGGDGFFSPSLHAGSPISSLSPRADTRRHGYPWLGSEQKADFLEARVAL

Enzyme Prediction     

No EC number prediction in SAPIO_CDS5997-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	333	432	6.1e-31	0.9345794392523364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	3.33e-42	330	433	6	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	6.34e-09	353	432	1	75	Starch/carbohydrate-binding module (family 53).
403835	Vac7	0.008	12	115	89	163	Vacuolar segregation subunit 7. Vac7 is localized at the vacuole membrane, a location which is consistent with its involvement in vacuole morphology and inheritance. Vac7 has been shown to function as an upstream regulator of the Fab1 lipid kinase pathway. The Fab1 lipid p[pathway is important for correct regulation of membrane trafficking events.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC78991.1|CBM21	4.01e-186	1	602	1	638
CZS72132.1|CBM21	3.37e-182	1	685	1	714
CCT66486.1|CBM21	1.19e-181	1	685	1	711
CEI38473.1|CBM21	1.24e-180	1	685	1	731
UPK90335.1|CBM21	2.03e-178	1	620	1	635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EEF_A	2.54e-10	343	432	46	135	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]
2DJM_A	1.53e-08	341	432	17	104	Chain A, glucoamylase A [Rhizopus arrhizus],2V8L_A Chain A, Glucoamylase A [Rhizopus arrhizus],2V8M_A Chain A, Glucoamylase A [Rhizopus arrhizus],2V8M_B Chain B, Glucoamylase A [Rhizopus arrhizus],2V8M_C Chain C, Glucoamylase A [Rhizopus arrhizus],2V8M_D Chain D, Glucoamylase A [Rhizopus arrhizus],2VQ4_A Chain A, GLUCOAMYLASE A [Rhizopus arrhizus],4BFN_A Chain A, Glucoamylase [Rhizopus arrhizus],4BFO_A Chain A, Glucoamylase [Rhizopus arrhizus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UQK1|PPR3C_HUMAN	6.48e-11	343	440	167	263	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
sp|Q7TMB3|PPR3C_MOUSE	8.67e-11	343	440	167	263	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q5U2R5|PPR3C_RAT	6.63e-10	343	440	167	263	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|Q0VCR4|PPR3C_BOVIN	1.59e-09	343	440	167	263	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1
sp|Q86XI6|PPR3B_HUMAN	9.20e-09	343	432	143	232	Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS5997-t41_1-p1.