CAZyme Information: SAPIO_CDS5940-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS5940-t41_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228		24677.48	4.1183

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000099:1850312-1851226(-)

Full Sequence      

MVTTNLLSTLALGLPGLVLGLRGRTFTSWDWQVNPREEATFPSSGLVTSCNVNNQPLSNS
RNVASGCDNGGAYMCDTYLPIPIADDFTYGFAVAPGYNCCKCYELFWLNGYAAGKRMVVQ
VVNWMPDEEEGTDAGKPGDFAILTPGGGSGPHSRGCTRQYGSTWGDDYGGVSSMTDCEQL
PENLQGGCYWRWNWAGGEITGWDVEYKEVECPARLTDISGCTPAPFQA

Enzyme Prediction     

EC	3.2.1.4:43	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	42	221	3.7e-44	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	5.59e-31	38	221	18	213	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ75963.1|GH45	4.34e-62	17	223	17	222
CAC94522.1|GH45	4.34e-62	17	223	17	222
VBB84601.1|GH45	2.20e-54	24	221	27	243
QYY49566.1|GH45	4.15e-46	23	224	29	231
QRV85206.1|GH45	1.53e-44	44	222	47	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HD5_A	4.88e-34	42	221	23	199	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]
6MVI_A	3.28e-33	42	221	46	221	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
2ENG_A	3.53e-33	42	221	23	199	Endoglucanase V [Humicola insolens]
4ENG_A	3.53e-33	42	221	23	199	Chain A, ENDOGLUCANASE V CELLOHEXAOSE COMPLEX [Humicola insolens]
3ENG_A	3.82e-33	42	221	23	199	STRUCTURE OF ENDOGLUCANASE V CELLOBIOSE COMPLEX [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45699|GUNK_FUSOX	1.52e-32	49	221	49	219	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	1.96e-32	42	221	23	199	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|D3GDK4|GUN_CRYAT	6.83e-29	47	225	47	225	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|O97401|GUN_PHACE	2.70e-23	23	221	40	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P54424|GUN1_USTMA	7.05e-19	38	221	43	234	Endoglucanase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EGL1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999713	CS pos: 20-21. Pr: 0.9695

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS5940-t41_1-p1.