CAZyme Information: SAPIO_CDS5389-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS5389-t41_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	JOWA01000098|CGC5	44347.00	7.3648

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000098:886994-888368(-)

Full Sequence      

MLFSGLKSVCVAALAASLVPAVKADCECGYSTTIGDSKEPSVFTELLESDFRRVNALGSE
TNWLLPAFNVTKEKTNGLYGLNFRPSNVITFNNKKKALWTRTEVTKPVATSGDGLELAVS
SKLDHDMASVAELDSRRADLKWGSYRTSMKLTDVPGTCAAFFWYFNETQEIDMEFLSKEF
DPKAGVYPVNLIVQSPKATDSNYDAAKAGNFIRAELPFNPTRDFHEYRFDFVPGEVHFYA
DGKVLAKIQGAAIPSNSGHLILQHWSNGNNVWSGGPPAKDTSVSVKYVKAYFNSTDTGHQ
HASNVRCAQAKDKKSSVCEIPDIAADKSAEDFFFGKLRLNQTLSRARFNFTNSSLDMNAR
TRTKSVEEEKEEKKKKEEEGSAAVWGATQAGLFALALLMTKV

Enzyme Prediction     

No EC number prediction in SAPIO_CDS5389-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	108	291	3.1e-83	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	8.41e-41	110	291	35	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	7.85e-10	143	287	69	205	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
225182	BglS	4.24e-06	110	282	84	250	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
395585	Glyco_hydro_16	1.37e-05	105	278	3	156	Glycosyl hydrolases family 16.
178706	PLN03161	0.001	108	273	42	196	Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK94444.1|GH16_23	2.85e-99	26	329	19	313
VBB86764.1|GH16_23	1.77e-98	18	346	37	370
CDP32289.1|GH16_23	1.77e-98	18	346	37	370
CEI68761.1|GH16_23	3.11e-98	8	323	4	305
QBZ62950.1|GH16_23	1.03e-97	18	353	37	369

PDB Hits     

SAPIO_CDS5389-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

SAPIO_CDS5389-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000245	0.999717	CS pos: 24-25. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS5389-t41_1-p1.