CAZyme Information: SAPIO_CDS5384-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS5384-t41_1-p1
• CAZy Family: GH1|GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	JOWA01000098|CGC3	58702.90	9.5787

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000098:869976-872092(-)

Full Sequence      

MWRRVYLLLVLVRLWFALSPSYLHPDENFQGPEVIAGQIFSYPVRHTWEFTSDHPIRSVF
PLWPVYGLPMLLLRWLWIGNGQAGEIPPIAVFWTLRVLMFVISFVLEDWAIHELIQSPRH
RRVAVLLVASSYVTWTYQTHTFSNSIESLIVAWSMVLIQRIVEAPHRSSLLSCTILSIVS
VFGIFNRITFPAFLVFPGVRLIPHLFNRPLSLGVMALAGLVTAVVAITLDTAFYSPAPLT
WADLIFRPVITPLNNLMYNISPSNLAQHGLHPWYQHLLGNIPMLLGPATLLAITRPYLSL
RLYSAISGIIVLSIFQHQEARFLLPTVPLILSSVQLPKNKTLLKMWTAAWIIFNVFLGVL
MGIYHQGGIVPAQVFMSGQPDATQVIWWKTYTPPIWLLNGKNEVLETRDVMGLRGEAVLE
DLERLATCDTPADRRNQEYLKEKNGTYLVAPTSATWLDQYLPNKGLNGLRFREVWRTRTH
LNLDDLDFAEDGVWGTLARVVGRRGLAVWRVTKSCP

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	397	2.2e-77	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	7.23e-49	15	396	12	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	0.001	249	379	266	426	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK89852.1|GT22	0.0	1	516	1	516
QLI65346.1|GT22	0.0	1	515	1	515
UQC77828.1|GT22	0.0	1	515	1	515
UNI14407.1|GT22	0.0	1	515	1	515
QPH02021.1|GT22	2.32e-316	1	516	1	516

PDB Hits     

SAPIO_CDS5384-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	8.71e-312	1	516	1	516	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	2.35e-184	1	514	1	540	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q4WTT7|SMP3_ASPFU	1.77e-182	1	514	1	544	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q5BAX7|SMP3_EMENI	4.18e-178	1	509	1	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	3.58e-96	3	490	6	498	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000306	0.999663	CS pos: 17-18. Pr: 0.9704

TMHMM  Annotations     

Start	End
5	24
60	77
89	111
175	197
210	232
272	294
348	370