CAZyme Information: SAPIO_CDS5378-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS5378-t41_1-p1
• CAZy Family: GH18|GH5
• CAZyme Description: Long chain fatty alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	JOWA01000098|CGC2	81426.97	7.7749

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000098:832596-835132(+)

Full Sequence      

MAATIAPNPPKLSTLPPTDFFTDKQWSILSALLDASLPSMAPKSAAKDRRAQVGVPEAEF
NRALERLKRVRGGDVPSDEALWGLLGDKCAADPMFVDNCKRFICSFPAEHQDALGDALKK
LSSRIGAYILTGYCTPYDTLPTHTRAKILESWRTSWIPQLRVLSKTIQQLAQKAYFQTNP
TFKQLSGYPDVPQDYKPGPGYDFQFLQFPASSDNSQVEISADVVIVGSGPGGSVCARTLA
EAGHSVLVVDKGYHFPPTQLPMPQTEACEYLFEGQGLLASADKSSSLVMGTCWGGSGTIN
WSVSLQTQDYVREEWAKKDGLPFFTSERFQKCLDRVCEAMGVSDKYIRHNHGNRVLLESS
EKLGWKAKPAPQNTMGKEHYCGQCHLGCGSNEKMGPAACYLPAAARAGAKFIEGFEVEKV
LFEEGEKKTKKAVGVVGTWVSRDKKGGVDGPAKEKITRRVVVKAKKAIVSSGSIWSPVIL
KKSGLENPQIGKNLHIHPCNFLAAAFKEEVKPWEGGIITSYCSEFENLDGQGHGPKLEPT
CMVPYIALASLPFSSPLEAKLSTLKYPHMNSYISLTRDRDTGSVTVHPTTGRPLIHYTPS
AFDARHTLEGVVGIAKLCYVAGAQEIYAFVPWLEPFVRSTPATTDDKVSAKDLIEKDAEF
KAWLDKVRDAGNKPGLGVWASAHQMGTCRMSSRAEEGVVDARGKVWGCEGLYVADASVFP
SASGVNPLVTNMAIADYIAANVVEDLKG

Enzyme Prediction     

No EC number prediction in SAPIO_CDS5378-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	212	745	6.7e-49	0.5161812297734628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	7.05e-59	269	499	2	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	1.43e-48	220	735	7	526	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	7.04e-30	578	738	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
223717	FixC	6.97e-09	218	252	1	35	Dehydrogenase (flavoprotein) [Energy production and conversion].
235000	PRK02106	7.13e-09	220	739	5	528	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	3.86e-211	2	746	6	734
CAK42323.1|AA3_3	7.09e-14	222	746	15	596
BCS02826.1|AA3_2	6.55e-13	219	739	9	595
BCS14479.1|AA3_2	6.55e-13	219	739	9	595
BCS22571.1|AA3_3	1.94e-12	222	746	15	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	4.84e-11	219	742	228	763	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4YNT_A	1.40e-09	222	747	7	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4QI4_A	7.45e-09	219	742	6	542	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	8.85e-09	219	742	228	764	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4UDP_A	3.03e-06	222	739	7	524	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	1.39e-88	22	747	28	747	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|B5WWZ8|FAO1_LOTJA	1.03e-81	121	747	99	745	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|O65709|FAO4A_ARATH	1.72e-79	121	747	67	723	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q94BP3|FAO4B_ARATH	4.76e-75	210	747	226	743	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|Q9LW56|FAO3_ARATH	1.53e-71	206	746	218	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS5378-t41_1-p1.