CAZyme Information: SAPIO_CDS5034-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS5034-t41_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	JOWA01000096|CGC2	35697.73	4.2081

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000096:262747-263975(+)

Full Sequence      

MPSSRSRGSMQRLALSGLLFLASAAARPNDRPSLSDVSIPSISLLGGNVTLRILPLGDIL
THGTPSSPSSYRSSLRDLLIADGNPVDYVGSSTSGSLDDNQVEAPSTVGTNPIASIQASA
ETAVPAYKPNLVIVNAGTDDCRQGKDVSNAGAELLKILETSWKNSIFVSVVLTTLVPSKD
ATVEACLEKVNTQITDLVVAQQARSQKVVLVDFRAADKGVTADDLTEEVDGEFFPSGEAY
GKMAALLFDGINNAASRGWLEAPEPLPNAPTPSPSGNGTSPSATGTGGVSAPTTGSGEAG
EGSSGGSETSGDQGVAEEAEGVKAGDQGSGAVRVGSGFLGVMGLVVGLGLAIL

Enzyme Prediction     

No EC number prediction in SAPIO_CDS5034-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	51	249	7.8e-36	0.9845360824742269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	6.90e-19	51	251	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	3.09e-06	53	249	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	4.46e-06	123	240	56	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
239945	SGNH_hydrolase_like_4	0.001	121	246	52	178	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC79481.1|CE0	3.48e-56	13	269	15	259
UNI21161.1|CE0	2.98e-41	9	269	9	257
QPG99528.1|CE3	2.86e-36	10	267	8	255
AVF19998.1|CE3	2.44e-35	46	263	12	222
AEO66483.1|CE0	3.33e-35	18	267	10	254

PDB Hits     

SAPIO_CDS5034-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

SAPIO_CDS5034-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000352	0.999628	CS pos: 26-27. Pr: 0.9525

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS5034-t41_1-p1.