CAZyme Information: SAPIO_CDS4783-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS4783-t41_1-p1
• CAZy Family: GH17
• CAZyme Description: Alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	JOWA01000094|CGC1	68552.75	6.3782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000094:330419-332792(+)

Full Sequence      

MRLLKAFSIGACVLGVVEALPRRVSDFSKRQVTQLRDEYDFVIIGGGTAGLTVADRVSAA
FPHRTVLVIEYGKIEQSVGYFDPPEDGKGVSRLVISSPPVESVNNRSAVVILGMTVGGSS
AANGQFFDRGSKYDYDEWARLGSPEFRGGEKWDWENLYPSFQKSSFLTEPSPELAAEFGY
TWDSASYGGDSIQASFPPFQWPIQGISWKAWEEFGLETPKDCANGNKHGLCWVPTAQNSE
TVERSHAGVGHYTNIAASRPNLDLLVEHKVTRLVVDKTQKVPAVEFRPVAGGDVKTIRPK
YEVILSAGAIHTPQILQRSGVASAKYLKSVGIKLVEDLPGVGQNFQDHCGPPITFSFDAP
HPSEADITNNATFAAEAVAQFRERPARGPYTLGMGNSAAYVSLPKITSEYKKIVAKIRKQ
ISDRSALQYLPAGASETVQKGYLAQLEVIAQALENPEHPILEAPFASSPGTAFLLKPLSR
GTVLLNPEDHDATPIVNYRTAANPIDIDIMVTYFDYFRRLYATDTWQSLNAVEVAPGANV
TDPSDIAEYIKNNIIQSLMHPCCTAAMLPREKGGVVDSKLTVYGIPGLRVADCSIIPTLP
AAHTTTTAYAIGEKAADIIIKRWQKDCKP

Enzyme Prediction     

No EC number prediction in SAPIO_CDS4783-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	38	621	1.2e-153	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.40e-64	38	622	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.34e-54	38	622	5	534	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.33e-26	477	615	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.02e-23	102	348	13	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.20e-11	22	600	35	557	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO67447.1|AA3_2	6.76e-200	14	625	11	642
VBB84441.1|AA3_2	2.77e-186	29	624	29	634
CDP31201.1|AA3_2	2.86e-178	29	628	29	638
QRD01783.1|AA3_2	4.92e-149	127	623	3	507
EGX43942.1|AA3_2|CBM1	1.66e-139	13	622	17	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	3.14e-205	1	623	1	642	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	1.45e-109	35	621	2	584	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	2.12e-53	38	619	1	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.08e-52	38	619	2	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	3.45e-49	39	619	6	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	2.47e-93	20	619	21	613	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.56e-66	11	620	13	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.56e-66	11	620	13	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|Q5B8A1|PKFF_EMENI	1.47e-55	39	621	41	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A1CFL2|PATE_ASPCL	1.85e-54	39	616	51	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.040259	0.959704	CS pos: 19-20. Pr: 0.9076

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS4783-t41_1-p1.