CAZyme Information: SAPIO_CDS4708-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS4708-t41_1-p1
• CAZy Family: GH162
• CAZyme Description: putative cellulose-binding family ii protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231	JOWA01000094|CGC1	25350.59	4.2682

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000094:63111-63888(+)

Full Sequence      

MLGVFGIAVLTTLLRGALAQQPLRCMPFGDSITDYGCWRPWLAEKLKEDGYTLDFVGSRQ
AQATCDDLDYDRDHEGHPGFQAVDIVKDKQLVGWLKDNPADIITMHLGTVDIVRSGTKAD
VILEAYSALVDQMRDSNPEIRIIVAQMIPYPANDGLVQELNAAIPEWAASKNSTESPIWV
VDQYTGFSGTTDLYDGLHPSESGDVKISGKFHPVIIQAIESIRGSGLEAEE

Enzyme Prediction     

No EC number prediction in SAPIO_CDS4708-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	23	214	9.6e-54	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	3.53e-47	23	215	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.97e-14	28	203	2	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	2.98e-14	28	203	4	176	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	2.82e-06	95	215	45	168	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	3.99e-06	26	208	2	221	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB71398.1|CE3	3.08e-74	19	226	23	236
CDP22404.1|CE3	7.20e-72	19	226	23	233
CAP59760.1|CE3	7.20e-72	19	226	23	233
QRD06229.1|CE3	4.93e-66	9	223	8	227
APU14667.1|CE3	6.72e-56	15	222	29	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	1.71e-40	23	222	2	206	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	4.80e-40	23	222	2	206	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

SAPIO_CDS4708-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999733	CS pos: 19-20. Pr: 0.9739

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS4708-t41_1-p1.