CAZyme Information: SAPIO_CDS4432-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS4432-t41_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		44001.59	4.3721

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000092:164454-165714(-)

Full Sequence      

MARSYRTLKGYLALLLVTLFTISSSAPASSLEARGSWTGLSSREFTEEGCRPIIFIYARE
TIAPGNMGFWVGPEISNRLKLYFGVDNVATEGVDYLAWRETNFYKGGTSPFGIFLMQVLL
TKAVTQCPTSKIVAAGYSQGAAVVHRAVQYLDEDIRDRITAVVTFGDTQTLQDGGRIIGF
PLDKTLIICNVGDIICTGTLYVFPIHLDYTKRVPEAVHWLIWKILSSYFNPPITPWYWWQ
HPPPGWKLPPGEGDGEGDGEEGDDDEDSSDDDNRWGTMLPPHLSMFPSIPVGDPAPTVTV
GIPPEPTEPDISDILSDYPELSTILTSHFPGFETELPEAPTAVPTHDPNFATTTTTVTVT
VTISQPIGSECPLPGEPTDEALNRRSGDSHGLSFWKRWW

Enzyme Prediction     

No EC number prediction in SAPIO_CDS4432-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	50	221	2.2e-33	0.9735449735449735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	5.70e-46	50	224	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX52366.1|CE5	6.90e-61	18	227	9	223
UQC73970.1|CE5	1.00e-60	17	224	5	224
QBZ62508.1|CE5	3.10e-56	21	227	13	222
QRC93889.1|CE5	1.72e-50	11	227	2	218
CBX93487.1|CE5	5.08e-50	13	227	5	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X88_A	3.55e-40	39	220	12	194	Chain A, cutinase [Malbranchea cinnamomea]
3GBS_A	4.98e-39	44	221	15	193	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	2.01e-38	44	221	6	184	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
1CUV_A	4.32e-38	22	209	1	191	Chain A, CUTINASE [Fusarium vanettenii]
1CUW_A	8.45e-38	22	209	1	191	Chain A, CUTINASE [Fusarium vanettenii],1CUW_B Chain B, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4MZV6|CUTI2_MAGO7	8.16e-48	13	224	4	214	Cutinase CUT2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CUT2 PE=1 SV=1
sp|A1C9G0|CUTI3_ASPCL	2.93e-44	13	224	5	215	Probable cutinase 3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_055320 PE=3 SV=1
sp|Q4X1N0|CUTI1_ASPFU	7.22e-44	19	224	5	211	Probable cutinase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_2G09380 PE=3 SV=1
sp|B0XRY3|CUTI1_ASPFC	7.22e-44	19	224	5	211	Probable cutinase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_025250 PE=3 SV=1
sp|A1DGN0|CUTI1_NEOFI	2.80e-43	19	224	5	211	Probable cutinase 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_084890 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000325	0.999649	CS pos: 30-31. Pr: 0.5984

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS4432-t41_1-p1.