CAZyme Information: SAPIO_CDS4428-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS4428-t41_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623	JOWA01000092|CGC1	67807.53	4.4910

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000092:142730-144672(-)

Full Sequence      

MKSLLLASILAAVSFAADEPEYETYDYIVVGSGPGGGPLAANLARAGYSTLLVEAGDDHG
DQSVYRELSNFNVAGNDERTRWDFFVKHSDDAERELKYERLTWRTADGGFYVGLDPPEGA
EQLGIYYPRAATLGGCAMHNAGVCSLPSADEWNWIANITGDDTWVAENMRKYLVQTEKNL
YMPAGSEGHGFNGWMSISTSDSSWATEGDWPANKILTKLAELTDQDPEKVGELVNKDILA
GGEDHLSSFYNMAQHGDSRGRRSSPNDYIKATLADEVKYPLKLALNTLVTKVLFDEEAET
PTAIGVEALQGQSVYRADPRHDPEGNKTLTRFYAKREVIVSGGAFNSPQILKLSGIGPKD
ELEKFEIPVVVDLPGVGENLGDNYEGSVLAIGKGPTGGSRITVLFRTPSAPTENRNIFAW
CGAFAFEGFWPGFPEDYGADEYTCAMVHMNPKSQAGSVRLASSDPQDSPDINFRFFEHEG
DKDLKELVEAANLLRESWQVAGDTVLPYDELHPCPGTGAGNCTVEEQAESFKLQAYSHHA
TSTCAIGADDDENAVLDSKFRVRGVKNLRVVDASSFPRVPGAFPVLPTAMLSAKATEEIL
ADAKAAVEKEKEAEKPAPKKCKK

Enzyme Prediction     

No EC number prediction in SAPIO_CDS4428-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	22	622	7.3e-76	0.5388349514563107

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	7.54e-55	39	607	22	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.38e-50	259	600	196	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.71e-30	451	595	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.67e-20	257	584	215	561	Protein HOTHEAD
366272	GMC_oxred_N	1.91e-13	125	385	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB81166.1|AA3	1.07e-267	4	605	5	616
CAP64871.1|AA3	1.51e-267	4	605	5	616
CDP29384.1|AA3	1.51e-267	4	605	5	616
QBZ53739.1|AA3	2.17e-241	4	608	65	667
QRD01027.1|AA3	2.83e-201	6	602	10	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	1.48e-31	20	595	3	556	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	2.68e-31	23	595	6	556	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	3.60e-31	23	595	6	556	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	3.60e-31	23	595	6	556	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	4.04e-31	23	595	22	572	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CJ60|ATC_ASPTN	2.12e-34	24	600	45	594	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	2.41e-34	24	599	40	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A1U8QYA8|CICC_EMENI	3.52e-33	25	603	36	611	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|C8VDT4|STCN_EMENI	4.27e-33	23	601	66	637	Versicolorin B synthase stcN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcN PE=2 SV=1
sp|Q8D3K2|BETA_VIBVU	2.49e-32	25	600	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000347	0.999623	CS pos: 16-17. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS4428-t41_1-p1.