CAZyme Information: SAPIO_CDS4357-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS4357-t41_1-p1
• CAZy Family: GH154
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	JOWA01000091|CGC3	41839.96	5.1294

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000091:525930-527376(+)

Full Sequence      

MHFKSLLLSSALFLSCSNAQLHKYAVAAGLKYFGTAVDNPALGNAAYMAIARDPDEFGMI
TPANGQKWANTEGSRGGFSYGMGDAVAGIVGAGRSMRCHTLVWHNQLPGWVSSVFSRADM
EAVIRSHITNVMNHYKGQCYSWDVVNEALEDDGKFRQSPMFRAMGEDFITFSFKVAEEVD
PSVKLYYNDFNIERYINDKIRATHALVKRAKESGARVDGIGMQDHARVGNAQSKKELMDT
MAFFSEVVDELAYTEVDIRHTKMPVTEADREQQAKDYMEVVAACLETEKCVGISVWDFTD
QYSWIPNEFPGEGDACLYDRNLQKKPAYHSVLSMLQSAAEAKTATGPESTATAVDAETTS
TSGAGTASTLSTVVVSSPTNAP

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	25	333	2.1e-87	0.976897689768977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	7.55e-115	21	333	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	5.65e-90	67	331	2	263	Glycosyl hydrolase family 10.
226217	XynA	2.58e-65	23	339	34	345	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80468.1|GH10	4.08e-164	1	339	1	338
CDP28815.1|GH10	8.22e-164	1	339	1	338
CAP67073.1|GH10	8.22e-164	1	339	1	338
ALF05564.1|GH10	4.03e-108	1	347	1	348
UDD65057.1|GH10	5.45e-108	1	335	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	1.69e-102	19	335	1	317	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	1.12e-97	17	333	21	337	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUF_A	2.11e-88	18	335	2	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	3.39e-87	18	335	2	312	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3U7B_A	5.45e-81	27	335	11	324	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P79046|XYN1_HUMGT	5.95e-108	1	335	1	337	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|G4MLU0|XYN5_MAGO7	1.87e-103	21	349	38	363	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|Q8J1Y4|XYN5_MAGGR	1.87e-103	21	349	38	363	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1
sp|Q5ZNB1|XYND_TALFU	5.81e-100	17	337	17	336	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|O60206|XLNA_AGABI	4.00e-90	20	332	18	328	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000351	0.999639	CS pos: 19-20. Pr: 0.9705

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS4357-t41_1-p1.