CAZyme Information: SAPIO_CDS4338-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS4338-t41_1-p1
• CAZy Family: GH13|CBM20
• CAZyme Description: Chitinase 18-4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	JOWA01000091|CGC1	44117.95	5.0300

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000091:450700-452045(-)

Full Sequence      

MRIFIALLLAAMAQLALGHLPKHRCLMYLTGQHPVVPEYRLTKHITHVALAFLNSNLFNE
DQPPEKWPIFATPDDLRDKFHPGTKFIVAVGGWGDTAGFDIAARDEESRERWARNVARMV
EELGADGVDVDWEYPGGNGEDYKQIPNSQKAWEIPAYPLLLQTLRTHLGPTPLITAAVPG
LERDMLAFTPTTVPQILPSIDFLNVMTYDLFNRRDNITKHHTGVRASKAALRAYMRRGAD
ACKLNLGFAFYVRWALTEGACERGKEVGCPTGLMEDPVTGGDLGRAGAFSYHDEVPADLK
DSYERALSEGTYDEIGGGYYYWDEEEKRFWTFDTPEAIAPKFEVLVRDLGLGGVFAWGLG
EDADEFRHLRVVDREMGRLWRDRDEERREL

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	42	366	9.1e-50	0.8513513513513513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	2.86e-73	24	362	1	307	Glycosyl hydrolases family 18.
214753	Glyco_18	4.19e-59	46	362	27	334	Glyco_18 domain.
119365	GH18_chitinase	1.09e-51	43	362	24	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
225862	ChiA	1.96e-43	43	365	63	426	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119349	GH18_chitinase-like	9.50e-39	25	211	1	179	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC88944.1|GH18	2.93e-154	24	374	68	417
CAE7199879.1|GH18	6.25e-154	10	372	14	379
QBZ56874.1|GH18	1.79e-152	24	373	29	379
EAA30374.2|GH18	5.28e-152	24	390	32	398
AEO60157.1|GH18	8.34e-152	1	385	4	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HM1_A	4.25e-20	45	362	31	380	Structural and thermodynamic signatures of ligand binding to an enigmatic chitinase-D from Serratia proteamaculans [Serratia proteamaculans 568]
4NZC_A	7.68e-20	45	362	34	383	Crystal structure of Chitinase D from Serratia proteamaculans at 1.45 Angstrom resolution [Serratia proteamaculans 568],4Q22_A Crystal structure of Chitinase D from Serratia proteamaculans in complex with N-acetyl glucosamine at 1.93 Angstrom resolution [Serratia proteamaculans 568]
4PTM_A	7.99e-20	45	362	34	383	Crystal Structure of Chitinase D from Serratia proteamaculans in complex with N-acetyl glucosamine, a hydrolyzed product of hexasaccharide at 1.7 Angstrom resolution [Serratia proteamaculans 568]
4LGX_A	8.18e-20	45	362	37	386	Structure of Chitinase D from Serratia proteamaculans revealed an unusually constrained substrate binding site [Serratia proteamaculans 568]
6KXN_A	2.06e-19	79	362	71	357	Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	5.72e-18	81	365	152	441	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|A6N6J0|CHI46_TRIHA	9.93e-18	79	362	118	390	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	4.13e-16	46	366	52	367	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|C5P230|CHI1_COCP7	6.21e-16	37	362	56	383	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
sp|Q9W5U2|CHI10_DROME	6.37e-16	28	369	1421	1758	Probable chitinase 10 OS=Drosophila melanogaster OX=7227 GN=Cht10 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000188	0.999776	CS pos: 18-19. Pr: 0.9818

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS4338-t41_1-p1.