CAZyme Information: SAPIO_CDS4178-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS4178-t41_1-p1
• CAZy Family: GH13
• CAZyme Description: Uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	JOWA01000090|CGC5	46960.71	6.2284

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000090:1189696-1191258(+)

Full Sequence      

MHILSVTAAVAVFLGAANVVAQVPQLPVPTTCTGVSAMRFPQYTVAPGWQFLKIAGGLQG
VRTIVFDPLGNMLVSEARKGISIHTFGENGCISASTMLISDISLNHGLALTPDGKTLYAS
SERNAMSWTYDPATRTVSNKKTVVTGMDSGIHSTRNLLVSPKSPNLVMLQVGSNSNLDMQ
SVQAATGRAIVKIFDMDKAPANGFNYKTDGEVLAWGLRNEIGFTADPNGHVWGVENSGDD
FRRNGADIHIDNPAEKLNFLGDPTKDRDQFFGYPDCFSVWDPTPFNGQLKTGDHFVINSQ
GGNTDAGCNDRAIKPRLTFQAHSAPIWNSFDANATNMYVTFHGSWNRQPATGFKVVEIPF
TQLENGQYDPVAAPDSREGYKDIFGATNPGSCTANGLTMSNCFRLTASTWDPAGRGLFVG
SDNASEGEIYLLSKKA

Enzyme Prediction     

EC	1.-.-.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	33	432	1.9e-148	0.9925187032418953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	5.46e-19	4	375	12	377	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
400653	SGL	0.009	96	146	127	179	SMP-30/Gluconolaconase/LRE-like region. This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30), gluconolactonase and luciferin-regenerating enzyme (LRE). SMP-30 is known to hydrolyze diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 and LRE.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB74956.1|AA12	6.24e-213	1	433	1	435
EAA28613.3|AA12	2.89e-209	1	436	1	438
AEO55799.1|AA12	7.76e-193	1	433	1	436
CDP24917.1|AA12	1.35e-179	1	433	1	429
UQC91657.1|AA12|AA8	9.15e-148	18	434	174	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JT5_A	2.27e-107	31	434	4	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]
6I1Q_A	3.65e-83	38	434	6	402	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	3.76e-83	38	434	7	403	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	3.87e-83	38	434	8	404	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q44091|SNDH_GLULI	1.31e-10	44	361	73	390	L-sorbosone dehydrogenase OS=Gluconacetobacter liquefaciens OX=89584 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999771	CS pos: 21-22. Pr: 0.9786

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS4178-t41_1-p1.