CAZyme Information: SAPIO_CDS4087-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS4087-t41_1-p1
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
202	JOWA01000090|CGC6	21564.17	4.1363

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000090:855629-856371(+)

Full Sequence      

MALGDSITGSPGCWRALLWQRLQAASITNTDFVGTLPGQGCSFTYDGENEGHGGYLSTNI
ASQGLLKGWLQSTKPDVVMVHLGTNDVWNNKSPEEIIGSFESLLGDMRDNNPAMKVLFAQ
IIPMAPSNCPQCGSRVEALNAAVAEWVPTVSTEESPVSVVDCWTGFDTAKMTGDGVHPNA
VGNEALADSWFEPLAEVIRSFG

Enzyme Prediction     

No EC number prediction in SAPIO_CDS4087-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	1	192	5.7e-58	0.9690721649484536

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.47e-57	40	194	7	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.43e-23	2	185	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.85e-22	2	188	3	182	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	6.44e-16	1	190	2	224	GDSL-like Lipase/Acylhydrolase.
238868	XynE_like	3.29e-12	1	188	3	198	SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEI12754.1|CBM2|CE3	5.44e-93	1	199	48	246
AGZ42187.1|CBM2|CE3	2.74e-90	1	198	175	372
QFY06540.1|CBM2|CE3	1.03e-89	1	198	35	232
BCY07749.1|CBM2|CE3	1.27e-89	1	198	160	354
UJP38557.1|CBM2|CE3	1.68e-89	1	198	49	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	1.20e-38	1	199	5	204	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	3.38e-38	1	199	5	204	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]
2VPT_A	2.43e-09	3	200	11	201	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	5.59e-16	1	200	47	266	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999987	0.000057

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS4087-t41_1-p1.