CAZyme Information: SAPIO_CDS4086-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS4086-t41_1-p1
• CAZy Family: GH125
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
923	JOWA01000090|CGC2	101775.28	5.2760

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000090:851031-854829(+)

Full Sequence      

MAKGPPCPANEKTPMKRVVGYFESSGKPRRRCHTVEPEDIPIGVYTHINYAHAHIDPESF
RIFLARLRDVSLYRDVTGLKKRNKNLKVFISIGGWAFTGPGLTRETFSRLATDPDKQRVF
FSSLVFFMSTYDFDGVDIDWEYPGAPNRGGRPEDFENMPVFIANLRKASQSSGTGRTGVS
VVLPVAYWYLQHFDIKNIAPYVDFFNVMSYDLHGTWDKTSKWAGPYLNSHTNLTEITEHL
GLLWRDDIDPAKVNMGLAFYTRHLTAASLDCMEPGCIYDIAEIMDLAEQPGPAAVLDPEA
AAKILQRGRQWVTYDDETTWHLKLTRARELCLGGVTVWAVSQDVSSGRFSRELQAATGYS
SPGSAEYDMGNGEMLQTAVGETLTDQCRWSGCGKECPNGYLAVPRREGSRMKGVMRDPTG
CIGGQTSVFCCPADRNMPWCIWSDFNNGRCGKENQSQCPSGWSEIGSHSLACRSNSHWQV
ACCAATGDFTDLSIRNYAACSWQGTPPKCSFDKGTDSACNNADGRQYLMDSYGGSGGAQC
SGADDSESPRAYCCDVDSQSHADWGDSAGLAQASPARRQSSDFATATGTQFTIDGETGYF
AGSNSYWISFLTNDADVDLVMDHFSSSGLKIFRVWGFNDVNSESNQVWYQLLSASGSRIN
TGANGLQRLDAVVASAEKYGVKLIINFVNYWDDYGGMNAYVKAFGGTKAGWYTNDKAQTQ
YRAYIAALVSRYKDSKAVFAWELANEPRCQGCQTDVIYNWAKATSEYVKSLDPNHMVTLG
DEGFGIAGGTSYPFQFSEGVDFAKNLAIETLDFGTFHMYPESWSVDSTNFPIEWIKAHGA
ACVAAGKPCLLEEYGMTTNHCGTEAPWQKASRTTEGVAGDQFWQWGDQLSSGQTHNDGHT
IYYNSADFKCLVTDHVAAIKSGN

Enzyme Prediction     

EC	3.2.1.14:2	3.2.1.78:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	615	885	3.8e-84	0.9930795847750865
GH18	15	348	1.5e-59	0.956081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	2.04e-66	17	343	1	334	Glyco_18 domain.
395573	Glyco_hydro_18	5.63e-61	17	343	1	307	Glycosyl hydrolases family 18.
119357	GH18_zymocin_alpha	1.29e-56	19	340	3	342	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
119365	GH18_chitinase	6.93e-56	18	343	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	2.30e-54	36	348	19	346	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC82142.1|GH5_7	2.28e-184	571	919	17	367
AGG69667.1|GH5_7|3.2.1.78	6.73e-169	585	921	29	368
AGW24296.1|CBM1|GH5_7|3.2.1.78	6.90e-160	580	919	117	459
ADO14134.1|GH5_7|3.2.1.78	3.29e-159	584	921	13	353
CDP31001.1|GH5_7|3.2.1.78	6.02e-159	584	921	30	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZIZ_A	2.86e-160	584	921	16	356	Chain A, Gh5 Endo-beta-1,4-mannanase [Podospora anserina]
3WH9_A	2.87e-151	583	921	2	344	The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger],3WH9_B The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger]
1QNO_A	2.18e-150	581	919	2	343	Chain A, ENDO-1,4-B-D-MANNANASE [Trichoderma reesei],1QNP_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNQ_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNR_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNS_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei]
3WFL_A	3.60e-141	583	919	3	342	Crtstal structure of glycoside hydrolase family 5 beta-mannanase from Talaromyces trachyspermus [Talaromyces trachyspermus]
4QP0_A	5.42e-68	581	919	2	356	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2B3C0|MANA_PODAN	1.07e-159	584	921	30	370	Mannan endo-1,4-beta-mannosidase A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=Pa_6_490 PE=1 SV=1
sp|Q2TXJ2|MANA_ASPOR	4.19e-157	583	921	43	384	Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=manA PE=3 SV=1
sp|B8NVK8|MANA_ASPFN	6.58e-156	583	923	43	386	Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=manA PE=3 SV=2
sp|A1D8Y6|MANA_NEOFI	5.74e-153	570	921	13	368	Probable mannan endo-1,4-beta-mannosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=manA PE=3 SV=1
sp|Q5AR04|MANF_EMENI	9.19e-152	580	919	87	430	Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000091	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS4086-t41_1-p1.