CAZyme Information: SAPIO_CDS3885-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS3885-t41_1-p1
• CAZy Family: GH115
• CAZyme Description: Chitin synthase G

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
818		92494.46	8.0035

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000090:3191-5950(+)

Full Sequence      

MSTYEVPEKIPPASSLLPPKNNSPSETREENVNTGFPRETCSSPSISLPRARPSYQRPTS
SYSLPELYEEWSAAPTKPPSGLRHYHTRKVKLVQGNVLSIEYPVPNTAITCDANDFTLKD
GYDLRPRMYNRYSELLVCITYYNEDKVLLTRTIHGVMQNIRDIVNLKKSTFWNKGGPAWQ
KIVVCVIMDGLECCDRDVLDIFATMGVYQDGVMMRDVDGSTTQAHLLSVTPSMLLVRPRD
DNPSTLPPVQFMLCVKSVNAGKINSYRWLYNSFCRILNPEVVINLDTGTKPEPKSLLGLW
EAFYNDKDLGGGCGLVRGEKGKGGRYLLNPLVAAQHFEYKVACQLERALESSTGYISVLP
GAFSAYRYRAIMGQPLSEYLRGDPTLHQHLGQSAPSNVLQLNRYLADDRILAFELVFKAG
HKWHTRLISNAEAVTDVPMNTTDFINQRRRWLNGSFSATVYSLQRFYLLFKSSHNPIRFI
ALLVQMLYNLAALLLAWFSLAGFLLTISVVSDIAGNPPEDAPVEGFPFGRATPIVNAVIQ
VTYFATVILQFIFALGSHAKTHALHYAVSFAIFAIVQLYLFMNLIYLSKRLIDFKADTNG
GSSYNYINEYYTDVGPLTVLVTAVSLFGIYIAAGLLYFDPWHLLVSWAQYMFISSSYINI
LKTYAFSNIHDVSWGHKSGKKPAAAQISVAIKTNSETEAPIEEVDRIQGDIDLAFEQTVR
RALSPYDREVAEDDDPQEKFMRFRTTLVAVYIFSNFLVCLIVMNDSIRSFSFLGDPYWHK
IWFFRIWMWGNSSILMMQFLGCLVQRFTAMVGCCFARR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	141	303	5.4e-56	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	2.37e-74	141	303	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	6.15e-63	137	458	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	2.60e-20	252	587	115	397	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
400626	Chitin_synth_1N	8.64e-17	89	140	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
133045	CESA_like	6.95e-14	271	372	71	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96843.1|GT2	6.19e-267	81	818	139	914
AAB07678.1|GT2|2.4.1.16	7.93e-267	74	818	129	911
QQK47409.1|GT2	2.33e-266	81	818	136	912
AFS18471.1|GT2	2.33e-266	81	818	136	912
AAK31732.1|GT2|2.4.1.16	3.76e-266	63	818	122	916

PDB Hits     

SAPIO_CDS3885-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54267|CHSG_ASPFU	1.41e-267	74	818	129	911	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2
sp|Q00757|CHSB_EMENI	6.12e-265	63	818	123	916	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P29070|CHS1_NEUCR	8.87e-257	72	818	133	917	Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-1 PE=3 SV=2
sp|Q92197|CHSC_ASPFU	3.69e-255	60	818	98	893	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2
sp|P30602|CHS3_EXODE	8.04e-255	69	776	117	866	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000000

TMHMM  Annotations     

Start	End
488	510
534	556
566	588
616	638
643	661
747	766
781	803