CAZyme Information: SAPIO_CDS3802-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS3802-t41_1-p1
• CAZy Family: GH114
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1247		135683.13	4.6892

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000089:322570-326924(-)

Full Sequence      

MAMPSPPRWSTNIPLGGHWLYRAISILLTVLTVLTPCVSADPPTALPQRATENDLKWQPA
LDYDRDGCYNVPAIDAEGNISEGLDPNFTTGPADCRDESDLDNSNAYSRQRCNSGWCVYL
YGYYFEKDVAIEHVANPGHRHDWEHIVVWVKDDKAEYVGASAHGSYSLRPADEVRWDGTH
PKIVYHKDGGSTHAFRFGNTDDDNVENHKGVWVRSPLVSYNGFPDGIRDQLFAYDFGAAT
IAFKDETFASNLEKAMPKIPVSQDCSQWGACHTEFGDAFLFDYGLDEGSPGTPDIPPPPQ
TPLPKIRVLPLGDSLTFGVLSTDGNGYRRQLHQLLVSGSDNEVDFVGSQESGTMTDNQHE
GYPGATIAQITQHARNVLYMRPNVILIHAGTNDLHKNVDVAGAPTRLGSLIDLATDECPD
ATVLVAQIIMAVDSSVEADRAAFNEAVVEVVASRQSAGKNVMIADMSQTLARSDFVDGLH
PNNGGYDKMAAVWYETIQAANKLGWMKDPVAPGNAPPADVTPTCPNGYAWLNMGEVGTGI
NYGMTIKWQNQGRFADGVGGANAGNVILADIDGDGLDDYILVGANGALNVWINNRDPAHP
WRNVGEIAVGVDGASPQNVILADVDGDGRVDYLRVDADGAVQAWINTCNSPVSRRRGREL
PGGRLARRGVFCPINNPAHLKWTRAGLIIPHYDGASRDAVLFADTTGDGRADYLLVSDAG
AVRAVSLQGDIMNPTRVNHGIIAVGVGNANRDNVRFADIDGDGRADYLLVGEKGDISAWQ
NTGPVGQPVWKKLGTIAVGVDGGQRENVRLANVNNDRRADYLIMNPSTGALDAWLNMPDL
EVVGPNVRLADIDGDGRDDYLYMDAVGGIRAWLNRGFVDHPDWVSIGLIAPGVPGGSRER
IRLADMDGDGRDDYLVVADNGAVTAWFNKGYTDHPAWNSAGVIAVGVDGATLNNVRFADI
DGDGRADYCVIWNDGSVSAWLNKGDARSPTWENQGKIAVGVDGSARDNVFLEDLNGDGKA
DYLMVTDKGAIYGWLNTGTDPKNIVWKNQGMVASGVSGATRQNIRFGNLDADGKFDYWLI
DDANSTQQTVSKILQQLRSLLSNATALENRYGLRPFTQEMARMGDKFTSSDTISGRRLLH
FNKPYEDLSARIQNLKISPLNCTRWVVKDKDSFNGLITDISYFVDRLHKLVPDTSSNFTC
TMMEEDFSEDLRTNKLKLVCDASRSRADIYSQGCHAKSANKVPIKDP

Enzyme Prediction     

No EC number prediction in SAPIO_CDS3802-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	306	497	2.2e-59	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398968	NPP1	3.88e-73	51	255	1	198	Necrosis inducing protein (NPP1). This family consists of several NPP1 like necrosis inducing proteins from oomycetes, fungi and bacteria. Infiltration of NPP1 into leaves of Arabidopsis thaliana plants result in transcript accumulation of pathogenesis-related (PR) genes, production of ROS and ethylene, callose apposition, and HR-like cell death.
238871	XynB_like	8.16e-49	306	497	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	2.14e-15	311	488	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
405210	HeLo	7.18e-15	1080	1206	70	155	Prion-inhibition and propagation. This N-terminal region, HeLo, has a prion-inhibitory effect in cis on its own prion-forming domain (PFD) and in trans on HET-s prion propagation. The domain is found exclusively in the fungal kingdom. Its structure, as it occurs in the HET-s/HET-S proteins, consists of two bundles of alpha-helices that pack into a single globular domain. The domain boundary determined from its structure and from protease-resistance experiments overlaps with the C-terminal prion-forming domain of HET-s (PF11558. The HeLo domains of HET-s and HET-S are very similar and their few differences (and not the prion-forming domains) determine the compatibility-phenotype of the fungi in which the proteins are expressed. The mechanism of the HeLo domain-function in heterokaryon-incompatibility is still under investigation, however the HeLo domain is found in similar protein architectures as other cell death and apoptosis-inducing domains. The only other HeLo protein to which a function has been associated is LopB from L. maculans. Although its specific role in L. maculans is unknown, LopB- mutants have impaired ability to form lesions on oilseed rape. The HeLo domain is not related to the HET domain (PF06985) which is another domain involved in heterokaryon incompatibility.
238141	SGNH_hydrolase	4.41e-13	308	495	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV31873.1|CE3	2.61e-189	40	836	58	830
UQC87654.1|CE0	1.62e-169	10	836	4	827
QNE74183.1|CE3	8.51e-161	15	930	8	782
QKW13404.1|CE3	1.10e-139	271	1077	260	1046
QDY07805.1|CE3	3.79e-125	289	1036	632	1363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GNZ_P	2.44e-21	55	255	25	210	Toxin fold for microbial attack and plant defense [Pythium aphanidermatum]
5NNW_A	2.81e-21	55	255	25	210	NLPPya in complex with glucosamine [Pythium aphanidermatum],5NNW_B NLPPya in complex with glucosamine [Pythium aphanidermatum],5NNW_C NLPPya in complex with glucosamine [Pythium aphanidermatum],5NNW_D NLPPya in complex with glucosamine [Pythium aphanidermatum],5NO9_A NLPPya in complex with mannosamine [Pythium aphanidermatum],5NO9_B NLPPya in complex with mannosamine [Pythium aphanidermatum],5NO9_C NLPPya in complex with mannosamine [Pythium aphanidermatum],5NO9_D NLPPya in complex with mannosamine [Pythium aphanidermatum]
3GNU_P	8.30e-21	55	255	25	210	Toxin fold as basis for microbial attack and plant defense [Pythium aphanidermatum]
6QBD_A	8.19e-19	55	255	25	210	Crystal structure of NLPPya P41A, D44N, N48E mutant [Pythium aphanidermatum],6QBD_B Crystal structure of NLPPya P41A, D44N, N48E mutant [Pythium aphanidermatum]
3ST1_A	4.30e-15	41	185	10	149	Chain A, Necrosis-and ethylene-inducing protein [Moniliophthora perniciosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|L7NCS1|NLP10_PHYCP	1.78e-21	43	255	33	231	NLP effector protein 10 OS=Phytophthora capsici OX=4784 GN=NLP10 PE=2 SV=1
sp|Q9RLB8|CESA_RUMFL	1.47e-16	306	498	44	261	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1
sp|L7NCR0|NLP1_PHYCP	3.48e-16	34	255	26	231	NLP effector protein 1 OS=Phytophthora capsici OX=4784 GN=NLP1 PE=2 SV=1
sp|L7NCQ4|NLP2_PHYCP	4.41e-16	43	257	45	245	NLP effector protein 2 OS=Phytophthora capsici OX=4784 GN=NLP2 PE=2 SV=1
sp|L7NCP9|NLP3_PHYCP	4.10e-15	43	257	29	235	NLP effector protein 3 OS=Phytophthora capsici OX=4784 GN=NLP3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.008745	0.991227	CS pos: 40-41. Pr: 0.9448

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS3802-t41_1-p1.