CAZyme Information: SAPIO_CDS3744-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS3744-t41_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		33675.18	8.4418

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000089:143935-145039(-)

Full Sequence      

MRLPRLLAYCVALLAAGTSVTAANPAGSCDGPRAVAAQPDEWNLDSGTCGTSHLRKRKDT
FFLRIMPLGASITQGEFSSDETGYRKSLRQQLRFDGWEVNMAGSRHSGSMSDNDHEGWPG
YRIDQVYNRAMASVPAFLPNLFTINVGTNDAIQNYDVGSAGERMLALLKYLRSQVPDATF
ILSTLLPLRSQPNNARYINTQYRSLVTRLRGEGWKIVLAEMDDGFITLNELLDGTHPNDG
GYRKMAHRFYLSISDAIKAGYLAAPHYAGFDDSASVATPACHRTIGRVWGSAMLVFAMLS
SGKLYF

Enzyme Prediction     

No EC number prediction in SAPIO_CDS3744-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	63	251	2e-58	0.9845360824742269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.02e-46	63	253	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	8.72e-16	68	250	4	185	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	5.83e-15	68	244	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238872	SGNH_hydrolase_like_2	4.84e-11	64	249	3	188	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	3.00e-10	65	249	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE62547.1|CE3	5.93e-59	61	265	54	258
CAP79838.1|CE0	1.47e-56	50	262	93	306
BCS30471.1|CE3	1.58e-55	51	266	46	259
AEO66483.1|CE0	1.78e-55	63	267	43	252
QPG99528.1|CE3	2.24e-55	63	265	45	251

PDB Hits     

SAPIO_CDS3744-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	2.79e-15	63	259	44	266	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000289	0.999662	CS pos: 22-23. Pr: 0.9692

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS3744-t41_1-p1.