CAZyme Information: SAPIO_CDS3545-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS3545-t41_1-p1
• CAZy Family: GH10
• CAZyme Description: Chitinase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	JOWA01000088|CGC10	47142.64	4.5204

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000088:2060720-2062184(-)

Full Sequence      

MKASWASAAFLLACGVCATPGPSIGTDDSHNSTTGPLAPRDDGIFKTASNAVTGTFKNAL
GIYGANFQPQDIPAGEITHVLYAFADIASDGTVISSDPWADTDKRYDTDSWGDVGNNVYG
CVKQLFLHKKKHRNLKVLLSIGGWTYSPKFAPIAATEEGRRKFASSAVKLVADWGFDGLD
IDWEYPQNAAEAQNLVDLLRTCRELLDAYAAEHAPGYHFTMTVASPAGAQNYNTMLLEAM
DPLLDAWHLMAYDYAGAWDSTTGHQANIYPDPSNAAATKFNTETAVNAYLQRGIDPGKLV
MGVPLYGRSFMNTQGMGLPYSGIGAGSIEDGIWLYKDLPRPGAQEVWDNVVEASYSYDPA
SQELITYDTVTSTTRKAEWLIDRGLGGAVFWEASGDRKGAGSLITTLANTMISLDGSQNL
LSYPISVYDNIRNGME

Enzyme Prediction     

EC	3.2.1.14:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	54	400	2.2e-72	0.9358108108108109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	2.23e-118	61	396	9	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	1.47e-111	61	396	10	334	Glyco_18 domain.
119351	GH18_chitolectin_chitotriosidase	9.54e-84	65	391	16	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
395573	Glyco_hydro_18	3.13e-83	63	396	9	307	Glycosyl hydrolases family 18.
225862	ChiA	1.61e-82	64	408	52	433	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA36073.3|GH18	1.76e-188	46	435	29	423
AEO70479.1|GH18	4.78e-187	32	435	76	487
QBZ56002.1|GH18	1.29e-174	61	426	128	495
VBB72338.1|GH18	1.26e-172	29	435	85	500
BAB40594.1|GH18	5.22e-163	36	435	24	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IGY_A	1.13e-149	62	434	27	402	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
6EPB_A	1.76e-149	46	435	33	422	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
6YLJ_A	2.32e-147	46	435	33	422	Chain A, Endochitinase 42 [Trichoderma harzianum],6YN4_A Chain A, Endochitinase 42 [Trichoderma harzianum],7AKQ_A Chain A, Endochitinase 42 [Trichoderma harzianum]
1WNO_A	2.55e-147	62	436	16	394	Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus],1WNO_B Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus]
1D2K_A	9.27e-147	62	435	14	390	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32470|CHI1_APHAL	3.66e-153	43	435	30	422	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|E9ERT9|CHI1_METRA	1.24e-151	36	435	24	423	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|A6N6J0|CHI46_TRIHA	4.64e-148	32	435	20	429	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|P48827|CHI42_TRIHA	2.09e-147	46	435	33	422	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
sp|Q92222|CHIB_EMEND	2.92e-146	54	434	8	394	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000485	0.999501	CS pos: 18-19. Pr: 0.9633

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS3545-t41_1-p1.