CAZyme Information: SAPIO_CDS3466-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS3466-t41_1-p1
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		44122.05	4.7549

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000088:1747197-1748518(+)

Full Sequence      

MKSLIVLALAASMAAEVVAQPHDHRGAHRHLKRRAAGSKVRRAPDVVTEWVASATETVYE
LDGKKIPKDEAAQGLDDGLFVVIGETTPKIEPEQGAQFYEKKPETTSTPEPEPTPEPEPT
PEPAPSPKPAKAASSGGTGLSAKFPSGTIPCSQFPSDYGAIPISYLGTGGWAGIQRCPNY
KPGDSSISYIETAVNGDGCTSGSFCSYACPPGYQKTQWPSAQGSTLQSIGGLYCNSDGFL
ELTRDGHDTLCEAGAGGVFIQNDLGQVVSTCRTDYPGTESMVIPTVLNPGEKQPLTNPYS
PNYYIWDGKPTTAQYYVNKKGVSVEDACLWDSSSNHDERGNWAPVNIGVGKSADGITYLS
IFPNTPTTSAKLDFNIKITGDVSIECELSNGAYTNGNPSGCTTAVRDGGVAVIRYY

Enzyme Prediction     

No EC number prediction in SAPIO_CDS3466-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	130	414	5.6e-103	0.8976897689768977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	7.61e-141	146	402	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC80645.1|GH132	5.37e-161	1	416	1	437
UPK97954.1|GH132	1.49e-150	1	416	1	437
QPG99169.1|GH132	1.51e-146	1	416	46	494
CEF73471.1|GH132	4.52e-146	1	416	1	443
QPC67105.1|GH132	4.52e-146	1	416	1	443

PDB Hits     

SAPIO_CDS3466-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	1.15e-93	7	415	6	414	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	1.64e-80	135	416	169	448	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|P53616|SUN4_YEAST	7.01e-78	138	415	157	419	Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUN4 PE=1 SV=1
sp|P40472|SIM1_YEAST	6.39e-73	138	415	213	475	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|O43015|YBOH_SCHPO	7.67e-72	144	408	59	312	Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.17c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000300	0.999683	CS pos: 19-20. Pr: 0.9745

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS3466-t41_1-p1.