CAZyme Information: SAPIO_CDS3256-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS3256-t41_1-p1
• CAZy Family: CE5
• CAZyme Description: Trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
650	JOWA01000088|CGC8	73052.72	4.3306

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000088:956390-958533(+)

Full Sequence      

MASTINRLAALLAAVPITQALYTDGNIVVPCDSPIYCHGDLLREVELARPFSDSKTFVDM
PGKKPLDEILAAFEKLEKPLKNDTVLQDFLSEYFAEPGGELVHVPPEELSTDPAFLDEVN
DTVIREFVSKVIDIWPDLTRSYVGSGECSDCPDSFLPVNRTFVVAGGRFREPYYWDSYWI
VEGLLRTGGDFVDISKNIIENFLDFVNDYGFVPNGARKYYLNRSQPPLLSQMVKAYVHST
NDTSILDRAVPLLIKEHEFFINNRSVTVTVGNKSYTLNQYNVDNNQPRPESFREDYITAN
NASYYAKSGIIYPEVEKLTDEQKALVYKNLATGAESGWDYSSRWISRPRDAADDVYFPLR
YLNIVGTVPVDLNSILYGNEIAIAELLEATGDEELARKWRSKAEDRSAAMYATMWNETLN
SYFDFNLTSNAQNIYVPADDDTADFERFTAPEDDLQVSFSAAQFYPFWTGAAPSHLKDNP
LAVKLAYDRVARYLDLRAGGIPATNFRTGEQWDQPNVWPPLIHILISGLLNTPPTFTDKD
PSYRATQDLALSIAQRYLDSTFCTWYATGGSTSETPQLPGLTDEDKGVMFEKYSDAAINR
VGGGGEYEVVEGFGWTNGVLIWIVDTFKNDLRRPDCGEIEAANVHPGRKL

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	51	626	1.5e-156	0.9938900203665988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	1.81e-138	51	621	3	502	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	4.02e-135	49	620	25	537	alpha,alpha-trehalase
224541	TreA	8.90e-90	33	633	53	558	Neutral trehalase [Carbohydrate transport and metabolism].
183934	treF	5.31e-79	40	619	61	538	alpha,alpha-trehalase TreF.
237326	treA	9.10e-79	33	625	43	534	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY63688.1|GH37	0.0	10	649	10	650
UPK93464.1|GH37	0.0	10	647	10	647
AEO53147.1|GH37	0.0	20	649	20	649
QPH18896.1|GH37	0.0	1	649	1	650
UKZ95675.1|GH37	0.0	9	646	10	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	1.09e-76	53	627	40	554	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	1.56e-75	53	627	40	554	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	3.91e-69	24	625	37	537	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	5.59e-69	39	625	15	500	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	8.10e-65	39	625	15	500	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	2.77e-115	17	636	35	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9JLT2|TREA_MOUSE	1.71e-103	30	631	24	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|A8J4S9|TREA_APIME	6.65e-103	30	635	40	576	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|Q9W2M2|TREA_DROME	1.16e-102	21	623	31	574	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	3.16e-102	30	631	27	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000323	0.999651	CS pos: 20-21. Pr: 0.9702

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS3256-t41_1-p1.