CAZyme Information: SAPIO_CDS3028-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS3028-t41_1-p1
• CAZy Family: CE4
• CAZyme Description: Glycosyltransferase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
914		103948.94	6.1076

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000088:786-3835(-)

Full Sequence      

MTSSKSSKSSTSSTGREGVDERPTSEIDNKPRGEQQSEIGCAHEPPTNAGSSITPRNMSD
SRLGTPNHSSRLPSSFVSHGTNSNRDAFMDLKADVVVASLYQDQRRRLYVSGWNINEGVV
LKRSKNHFVCQPPQLREIRDSFFDSVSQLNVSASAQKVAMTVNTPWVQSIVSTIRARDFY
IDSIPLHGGLNLQVLQRMTDLPRCQKHHFAAFVVEPPLLVVWDDDPNKIIKRIERLEADI
VSLVWKTEMEDDDEEPPSDTKEYYGDEEEGETMEVRPVRLTRATMVGMSLALALVCLGLG
WRALALEIMLDGYYLRLLLLLASPIQLFVSLFFFQTIIGNIFQILGPISAVNSNSRHYSG
KAPRRLGRDTELPHVTIQMPVYKEGLNAVIRPTIASLKAAISTYEMQGGTANIFVNDDGM
QLIDESLARARRDFYEEHNIGWVARPAHNPKPEDPSKEKPFIRKGKFKKASNMNYCLTTS
NKVEDKLQEIQRPAGWTRQDEEAAYERCLAEVIQESEGRTWAGGNIRMGDYILLVDSDTR
VPRDCLLDAVSEMEQSPEVAIIQHTSGVMTVTESFFERAVTWFTNLIYTSIKFCVANGDI
CPFVGHNAILRWRALQDAAAYIDPDDNTEKYWSESHVSEDFDMALRLQSAGYVLRFAAYS
NGEFQEGVSLTVYDELARWEKYAFGCNELLFHPLRFWLFRGPFAPVFKQFITSKIHFYHK
LTIMAYIGTYYAIGASWVLTLMNYFLTGWFFGLYDKYYIDSFAIYLSIIVVFPLMGNFAL
SILRYRLGEEDLLSALWTNFKWMPLFTIFLGGISLHVSKALLSHFFEIDIQWGATAKEVE
RVNFLEEVPKILRTFAGTFIFCIGCTALIICGYYVFPREWQIRYFASIYPLSSVIVTHFC
VPVLLNPALMKFTF

Enzyme Prediction     

No EC number prediction in SAPIO_CDS3028-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	531	751	1.4e-49	0.9137055837563451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.96e-47	531	739	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.00e-14	529	844	138	439	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.04e-10	377	640	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133034	Glucan_BSP_MdoH	1.13e-10	487	678	40	243	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
235476	PRK05454	1.38e-08	491	751	169	437	glucans biosynthesis glucosyltransferase MdoH.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC78319.1|GT0	0.0	82	914	102	935
AEO56958.1|GT0	0.0	40	913	62	955
AEO63469.1|GT0	0.0	35	913	100	980
VBB76138.1|GT0	0.0	30	913	47	940
EAA31611.3|GT0	0.0	82	913	47	876

PDB Hits     

SAPIO_CDS3028-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0RNI5|OPGH_XANCB	1.90e-06	529	685	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=opgH PE=3 SV=1
sp|Q4UYZ8|OPGH_XANC8	1.90e-06	529	685	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=opgH PE=3 SV=1
sp|Q8P532|OPGH_XANCP	1.90e-06	529	685	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=opgH PE=3 SV=1
sp|Q3BXV7|OPGH_XANC5	3.29e-06	529	685	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=opgH PE=3 SV=1
sp|Q83Z42|OPGH_XANEU	3.29e-06	529	685	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas euvesicatoria OX=456327 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000002

TMHMM  Annotations     

Start	End
283	305
320	342
724	746
761	783
795	817
854	876
883	905