CAZyme Information: SAPIO_CDS2762-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS2762-t41_1-p1
• CAZy Family: CE3
• CAZyme Description: Choline oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	JOWA01000087|CGC3	59967.27	7.3330

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000087:126334-128021(+)

Full Sequence      

MSISDNLPTGDAARFDYIIVGGGTAGCVIASRLSGYLPQKRILVIEGGPSDVGDSRALVL
KDRVQMLGTELDMRYPSVQQPMGNSHIIQSRAKILGGCSSHNDMVSFRTPEYDAYTWEKL
GCKGWSFDMFQRVQRRLRVATRPRAHPQDQNQLSKDWILSAHRALGLPYVSNLNNAISSS
AGLTQAVGWTPLSYNPDNGWRSSASVAYIHPILRGEEERPNLVILTNAWVSRVNVRGDVA
VSVDVTTRDGTKHTVHASTEIILCAGSIDTPRLMLLSGLGPRKQLESVNVPVVKDIPGVG
ENLQDHPCTFVVFDLHRDVPSQTATHSDVLAFLRHKPYNWAGDDGNVPDLELHMWQLDWC
DETTRLGYERPKRPFCILPVLLRPQTSGRLYLKSNDPNEKPALDFKYFEDPAGYDAELLV
AGIKASRKMAETQPFKSWIKREIAPGPNVTSDEDLNKYARAASHTIYHPACTTKMGDVDK
DPMAVVDPRLKVRGIKNLRIADAGVFPSMITVNLMLTVLAVGERAAEIIAEDAGWTGRDS
HL

Enzyme Prediction     

No EC number prediction in SAPIO_CDS2762-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	12	540	1.4e-89	0.5194174757281553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.17e-112	8	534	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	6.62e-99	14	529	5	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.21e-41	384	525	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	9.82e-31	15	308	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.72e-28	1	522	43	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK99666.1|AA3_2	1.03e-250	4	535	3	535
ATQ35968.1|AA3_2	7.05e-244	1	542	1	542
CAK47101.1|AA3_2	1.79e-239	1	542	1	542
BCS15458.1|AA3_2	3.61e-239	1	542	1	542
QKX54836.1|AA3_2	5.12e-239	1	542	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	4.47e-95	5	529	4	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	8.84e-95	5	529	4	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.75e-94	5	529	4	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7AV4_AAA	1.54e-51	3	533	72	640	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	3.22e-51	3	533	12	580	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	2.30e-94	5	529	4	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	5.49e-67	15	542	2	540	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q47944|SDH_GLUOY	4.97e-66	15	533	5	531	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q8NE62|CHDH_HUMAN	5.26e-64	14	529	40	571	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q8BJ64|CHDH_MOUSE	1.06e-63	14	529	42	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000010

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS2762-t41_1-p1.