CAZyme Information: SAPIO_CDS2736-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS2736-t41_1-p1
• CAZy Family: CE3
• CAZyme Description: Alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
656		71283.05	4.4983

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000087:31604-33970(+)

Full Sequence      

MAPTRALVLLGTLALASALPHRNGIGRVVKRQVEELRDSYDFVVVGGGTAGLTIADRLSE
AFPERNTLVIEYGVVEDAEAVFEPPGGGPGNKRLNIQSLPIPALNNRRASLTVGMTVGGS
STINGQFFDRGHKLDYDDWAKIGSPEFDESEESWDWDNILPFFKKSVTFFEPSEENAELY
GYTWDVDAAYGENVSHIQAVYAQYQFPVQKIAWDAFIEMGLPSPKECAGGDKHGVCWVPA
SQYYLDGQRSHAGRGHYLEVIEDRSNYDLLAGHKVTRLIVGEADAPPAIEFKPVDSDSED
DVKTVTPKLEVVVSAGAIHSPQILQRSGIGEAEFLEAAGIEVVVDLPGVGHNFQDHCGPG
SSFALAESIQPSQGSINSNETFAKEALDLYAERPAKGPYTLAMGNSAIYLSLPVITEDSA
DIVAAIRAQIEDGSALDYLSEGTPESVKDGYLAQLAVLADALENPEHPVLEAPWMSSTPG
GGFLLKPLSRGTVQLNPEDHDAEPIVDYRTGANPIDMEVMSRFLPFFRRYYETETMQALG
AREVSPGANVTAVEDITEYIRNTITPSFMHPCCTASMMPKEKGGVVGPDLKVHGLERVRV
ADISIIPIIPGTHTSATAYAIGEKAADIIIRSWPSEEAEEPVKEAPKCKKRRSQKH

Enzyme Prediction     

No EC number prediction in SAPIO_CDS2736-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	39	630	6.1e-146	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.47e-72	39	631	7	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.01e-68	39	656	5	558	choline dehydrogenase; Validated
398739	GMC_oxred_C	6.41e-33	487	625	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	7.53e-24	102	356	12	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.09e-09	39	631	55	578	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO67447.1|AA3_2	3.66e-196	6	633	7	640
VBB84441.1|AA3_2	2.20e-176	12	633	16	633
CDP31201.1|AA3_2	1.40e-167	12	636	16	636
QRD01783.1|AA3_2	2.07e-149	128	633	3	507
EGX43942.1|AA3_2|CBM1	2.83e-132	25	629	28	618

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	2.20e-207	7	637	8	646	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	7.92e-106	36	629	2	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	1.13e-50	39	629	5	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	3.20e-49	40	633	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	2.54e-46	40	629	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	1.05e-91	1	629	1	613	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	2.49e-61	39	630	46	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	2.49e-61	39	630	46	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	6.10e-59	39	629	39	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|V5NDL4|PDH1_AGACM	1.91e-51	40	633	37	594	Pyranose dehydrogenase OS=Agaricus campestris OX=56157 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000693	0.999267	CS pos: 18-19. Pr: 0.9627

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS2736-t41_1-p1.