CAZyme Information: SAPIO_CDS2705-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS2705-t41_1-p1
• CAZy Family: CE3
• CAZyme Description: Neutral trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704		79950.79	4.6004

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000086:1716982-1719409(+)

Full Sequence      

MGNPVETSQPGAEAAAEVAVPAGANEGGNAVNEPKQPVEESKKGGQDEDIEFKLDVEKTL
ERLLEQEDTDKDMQITKADGGPMSVELPTATPDGPGTYTLTGHYNVSNLLQELTIAKDDG
LKELTISLSRLNENPVHRLARRIREDFWDKLTRRIDASTVEIAAVDPKDWTDDPRPRIYV
PHGEPKQYEFYKKVAADRPEIRLDVQMLPEKITPELLRDLNLRPGLLTVAMEEVTDPKSG
EKTLRGVPFVVPGGRFNEFYGWDSYFESLGLLVNDRVDLAKGMVDNFCFCIKNYGKILNA
TRSYYLCRSQPPFLTDMTLRVYERIKDDEGSKEWLRLALLAAIKEYSSVWTAEPRYDAGT
GLSRYLPEGLGVPPETEPGHFSTVLTPYAEKHGMTYDEFVEAYTWGKVKEPELDTYFEHD
RAIRESGHDTSYRLENRCADLVTVDLNCLLYKYETDIVKAIRTYFDDSLVVPEEYSAGSN
LQPGEILTSALWEERAEKRKQAIQKYCWDEEKGWFFDYDIAKKEQTGYESATTLWTLWAG
VATKEQAERLVKKTAVPKLEAYGGLTSTTEASRGELGPDRPQRQWDYPYGWAPQQMLAWE
GLRRYGYENEACRLAYKWLYMMATAARDYNGVVVEKYDVTRKSEPHRVDAEYGNQGLGFK
GVAKEGFGWVNASFVVGLQYLDPNHELGLEKMLPWENSLDPLST

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	133	680	1.9e-150	0.9653767820773931

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	0.0	117	681	1	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	9.07e-173	53	683	10	554	Neutral trehalase [Carbohydrate transport and metabolism].
215307	PLN02567	3.61e-53	248	671	142	534	alpha,alpha-trehalase
183934	treF	3.04e-51	248	671	161	536	alpha,alpha-trehalase TreF.
237326	treA	3.23e-50	248	682	149	534	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO56949.1|GH37	0.0	52	696	84	726
CDP26053.1|GH37	0.0	52	696	89	731
VBB76134.1|GH37	0.0	52	696	89	731
CAP73650.1|GH37	0.0	52	696	89	731
AAS67888.1|GH37|3.2.1.28	0.0	52	695	76	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NIS_A	5.03e-254	55	694	6	638	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
5JTA_A	9.58e-253	52	694	98	733	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5N6N_C	3.70e-251	52	694	103	738	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5M4A_A	6.73e-241	107	694	5	585	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
2JG0_A	1.59e-44	248	686	115	507	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42783|TREB_NEUCR	0.0	52	696	83	726	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2
sp|A0A384JRP0|TREA_BOTFB	1.40e-317	34	696	54	719	Cytosolic neutral trehalase OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TRE1 PE=3 SV=1
sp|O42622|TREB_MAGO7	5.03e-315	52	702	76	724	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2
sp|J5K1E2|TREA_BEAB2	3.28e-310	52	695	79	724	Cytosolic neutral trehalase OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=NTH1 PE=1 SV=1
sp|O42777|TREB_EMENI	4.25e-298	52	696	89	731	Cytosolic neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS2705-t41_1-p1.