CAZyme Information: SAPIO_CDS2485-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS2485-t41_1-p1
• CAZy Family: CE16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1497		169035.62	6.7438

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000086:855050-861084(-)

Full Sequence      

MSRHERVPRRYRLDNQSRAGHDGIGHPSITLFSEDNVFPSSFKFTFDTIRDNVFRLCFTS
DTHPLPPYPSVKPPSVVLAETPKIDFNLDRQTKTIKTGKAEALVEWSSTPIVCLKLTGGH
EPIYEDLSFRSYVVDGPGIAHYSKYKKHTLHVGLGEKAAPMDLSGRHFSITASDTFGYDA
YLTDPLYKHIPLLINITRHGCVGVFSTTHARATWSIGSEIDGLWGHFKAYRQAYGGLEEY
LIVGKKVEEIVRTYAEIAGFPLLVPRYMMGYVGGGMKYSMQDQPRAADAILRFLSECEEK
DIPISAFQMSSGYTVAETEPKTRNVFTWNRHRFPDPRVFTRECLRRGVRLLANIKPYVLA
NHPEYKKLVDAGALFYDPVTKSSAVARLWSAGGGESGEGGHIDFTSKTGFEWWYNGCRAL
KEVGIDAMWNDNNEYNIPSDDWVCALETVVAGEAQKASERATAGTMRYASCSWGGDNVTS
WESMKGGNALALNAGFSLLQCYGHDIGGRYWEIKPPEINVVRSADYQTQGFEGPQPSPEL
LSHLTAVPPQKWTGWGYESDPEVWGKEITNGETQYWLGDALLIAGVYEPGKTSARVYLPK
NTEHSAIDWGFLNTNAPYQHLPSGQWHTVTSAWYDSIPVLAKCGTAVPVGKNRVTTCRRG
IQEDEDEFPGMEKDDWRGLEIFPPPKCFGRSVELSSIPNGSFTFENSWMEDDGISAQSKL
DICTVRVAYTISSVPGDGIIVKVAVEKTKSWEPLWLAHGLDVILPVGEERSNFNESHSVP
ALLKVETGEGGDGGISNAIRNEKYSALSWCWGSDDTLKHEIYIHEGNDVFSLGVRKNLYD
ALLALRRTNKNITLWVDAVCINQNAFFERNHQIQLMSLIYGLAESVLVWLGEADDDSKAA
MRFIREKMLQLSQFDECFKEDAAPKWRSFLNFMRRPWFSRSWIIQEIALARDAKVICGRQ
DSDRIQWDDFADAVQLFVDIETSSHRISNLIQKRTDFHNKPRTFEDVSSLPAAILVEATR
SLFGKYDAGLDRGTQREPVMKLEYLAWHFSVFEVTVPHDSIYALLSISSDAVPAGARKSP
EATDSNEPVPNAPTNTDILKKYKSELIEWTVSHSRRTHARQFTVDYEEDYVEACREFVEF
CIHNADPSRALDILCRPWSQPQEKIGSPTLSARNYSATGRKPVASRFLRFDSPKSPDYYN
MFVFGFELDEIEEVQDASQGGHVPIEWARACGWTSVDQQAPEEFWRTLVADRGWLSATPP
KYFSRACQEAFRSAFYTGYLRPSDHISHGHSSVLADFCRRVEVVVWNRALVKTKSNRIGL
VPKGVQKGDLVSILYGCSVPVILRRFKKNATEYEREKMEKDKEKKEKWAYHAKNFISAIE
RRRTRRRESNAQTALSPISPRAQAFFSDSVPTKSARSHSSMSPSKAPMKPPKPDRLLSER
SAVVDFDSYDSDPFSALTPTQHYHLFKGECYIHGMMDGQAIQYREKSGIQNSLFEIR

Enzyme Prediction     

No EC number prediction in SAPIO_CDS2485-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	240	510	3e-44	0.629976580796253

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269885	GH31_glycosidase_Aec37	1.32e-90	259	541	1	278	E.coli Aec37-like. Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37. The gene encoding Aec37 (aec-37) is located within a genomic island (AGI-3) isolated from the extraintestinal avian pathogenic Escherichia coli strain BEN2908. The function of Aec37 and its orthologs is unknown; however, deletion of a region of the genome that includes aec-37 affects the assimilation of seven carbohydrates, decreases growth rate of the strain in minimal medium containing galacturonate or trehalose, and attenuates the virulence of E. coli BEN2908 in chickens. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
224418	YicI	5.91e-63	122	683	125	693	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	3.02e-59	240	647	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
369159	HET	2.46e-35	804	946	1	146	Heterokaryon incompatibility protein (HET). This family represents a conserved region approximately 150 residues long within various heterokaryon incompatibility proteins that seem to be restricted to ascomycete fungi. Genetic differences in specific het genes prevent a viable heterokaryotic fungal cell from being formed by the fusion of filaments from two different wild-type strains. Many family members also contain the pfam00400 repeat and the pfam05729 domain.
269876	GH31	1.14e-21	259	522	1	226	glycosyl hydrolase family 31 (GH31). GH31 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC87212.1|GH31	4.75e-301	28	771	25	847
QIX00676.1|GH31	3.74e-267	44	777	37	829
KAF2454954.1|GH31	5.83e-259	1	773	1	824
ALG00081.1|GH31	6.45e-259	27	779	22	834
QLI69604.1|GH31	8.22e-259	1	786	1	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2G3M_A	4.04e-19	152	508	65	448	Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_B Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_C Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_D Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_E Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_F Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3N_A Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_B Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_C Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_D Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_E Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_F Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus]
5F7C_A	1.22e-17	153	525	206	569	Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5IEG_A	1.95e-13	137	648	219	779	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
5IEF_A	1.95e-13	137	648	219	779	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IED_A	1.98e-13	137	648	241	801	Murine endoplasmic reticulum alpha-glucosidase II with castanospermine [Mus musculus],5IEE_A Murine endoplasmic reticulum alpha-glucosidase II with 1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4R4N7|GANAB_MACFA	1.44e-19	137	648	251	811	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1
sp|Q14697|GANAB_HUMAN	1.67e-18	137	648	251	811	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3
sp|P0CD66|AGLU_SACS2	2.08e-18	152	508	65	448	Alpha-glucosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=malA PE=1 SV=1
sp|D0KQM8|AGLU_SACS9	2.11e-18	152	508	65	448	Alpha-glucosidase OS=Saccharolobus solfataricus (strain 98/2) OX=555311 GN=malA PE=1 SV=1
sp|P96793|XYLQ_LACPE	2.89e-15	145	441	147	423	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000001

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS2485-t41_1-p1.