CAZyme Information: SAPIO_CDS2447-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS2447-t41_1-p1
• CAZy Family: CE15
• CAZyme Description: putative beta-glucosidase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860		94683.46	6.2710

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000086:743900-746762(-)

Full Sequence      

MANTGMDRSFLTASVEDLVRHMSLTEKVAFIAGEDWWRTVALRRLNIPSVKVTDGPNGAR
GQSFSKMTPAVVLPDATCLAATFSQALASDAGRLLAAEAKARSSVCLLAPTVIICRSPLG
GRAFESFSEDPTLSGIVASEYIKALQAEGISATIKHFVANDQEHERMGQDSIIGPRALRE
IYLRPFQIAQARASPWSYMASYNKLNGTHCSEHDWLLKQLLRTEWGFDGLVISDWMGTYS
VAEAINAGLDLEMPGKPRWRQLQLVRQSINAHKILPETLDERVTTVLKWVQKLASLNPDI
VYGQDDSIEWTRKEHQEADAALVRRIGNEGIVLLKNEQSTLPIRQGKVAVIGPNAKNAVI
MGGGSARLRPAWCVSPWQGLVDNKPDRVELSYTLGCKGSKFLPILGEEFTSMDGATPGFD
ILHYAIIGGRQASRPAVSEVWKNSDIMLADFHHPDLGEDYFTEIRALFTASITGDWQFEV
SVTGQAWLYLDDELVADLSKGQKRTSSFFGNGGNGTIITVPVTKDKVYRFRLVHDSRKPP
LAPGQDSQPLQLIGIKLGSLPVIDEDQTIDKAVELARASDVAVLVVGLDQDWESESYDRP
NLSLPLRLNDLVHRVATEAPDTKMVVVLQTGSAVSMPWLKHVDSVIWPWYGGNEAGNAIA
DIVYGKVNPSGRLPISLPKRELDIAANLNFKSARTKTYYEEGIWVGYRHFNARGIDPMYP
FGHGLSYTTFEYSELTVSASASALPSSWRINVSTKVTNTGSVPGAHSVHFYTTPPPPTSN
SLIHPEVTLQAFAKTAVLSPGHSETVSIEMDKYAISHWDELTSSWRAEPGQWQVQIGRDA
QTMCAKESFTVPPGFQWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	43	254	5.3e-60	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.73e-72	40	850	97	763	beta-glucosidase BglX.
224389	BglX	5.94e-64	37	366	50	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	3.80e-48	11	811	49	743	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	2.53e-46	331	727	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.14e-38	40	287	59	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ91447.1|GH3	0.0	1	860	1	860
QKD55271.1|GH3	0.0	1	860	1	860
CBX93190.1|GH3	0.0	1	860	1	861
AUB23806.1|GH3	0.0	1	860	1	862
AFR94189.2|GH3	0.0	1	860	1	862

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.41e-179	15	860	6	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.56e-175	15	860	6	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.06e-117	11	851	1	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	5.00e-99	27	851	35	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.13e-98	27	851	35	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA18|BGLK_EMENI	1.03e-197	15	860	13	838	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|A1DNN8|BGLJ_NEOFI	4.01e-195	14	860	13	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	2.52e-192	15	860	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	2.52e-192	15	860	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	2.88e-192	14	860	13	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS2447-t41_1-p1.