CAZyme Information: SAPIO_CDS2430-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS2430-t41_1-p1
• CAZy Family: CE1
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		84439.26	5.0332

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000086:680460-682926(-)

Full Sequence      

MAAAVNPRDVAPYLNPSLPPPERAADLLDRMTWEEKIGQLGGVRRAFGTSTGKPTFNRSS
FETVHATQNGQVGYGPQANWAHDLLPMMNGLRAEQLNSSRLGIPYIVIADSVNGLWFSGG
TLFPGTVSMASSWNLPLYGDVVAAIRDENLAMGVNWVLSPEVDITRDPRNGRNGEMYGED
TYLVGEFATRYVQTMQEKDDGGWVKIATTIKHFVFGAGSGGVNRASMEGGINHILNDLAP
PYRKVIPEAQPMSLMASYSTVDGVPMSINKYLLQDVLRSILGFEGLIMSDANAIEYLFTE
AKVASSREDAALKALAAGLEHELHPGGHGLFSDLIDPAHGGDPSIASLVNESVRAFLEIK
FATGMFDRPLPTVENMKATLRNKRHLGLNRNITRESLVMLKNDGFLPISRDQISSSEGKI
AVIGPYADIINAGNYAPADPLDRRYGDSIRRSFERELGRDKIVYAKGTSTILPNYDDDGS
ADDEAIAEAVDVAKGADLAVIVLGSGFGNFDTSFINNDRTDTEGFAHADLGFPGKQQHLL
DAVLDTGVPTVLIMNSGQTFVINDSTMSRCRAIFHAWLAGEFTGDAVVETLLGQVNPSGK
LTVTMPQHNGAFPAAYDFLPSDAVGGFGGATLYDWHWPQLTRKAPLAFGFGLSYTTFNFS
RASISTQQQRRGNDTSAVSVSVTVTNSGDVAGKEVVQLYYRPQHTIIEFPVMKLIRFVKI
TLEPGESKEVVLNTVPIKELGYFVNGKWNVDRGNYSFWVGSSSRGEDLTCLDVYIF

Enzyme Prediction     

No EC number prediction in SAPIO_CDS2430-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	97	321	1.4e-52	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.76e-99	15	739	26	727	beta-glucosidase BglX.
178629	PLN03080	5.04e-58	12	740	41	748	Probable beta-xylosidase; Provisional
224389	BglX	1.56e-54	31	433	1	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.87e-46	32	298	1	262	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	4.02e-41	397	654	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC84058.1|GH3	1.94e-277	13	764	31	765
QKD60600.1|GH3	8.29e-241	3	768	21	764
UDD59312.1|GH3	2.38e-240	22	775	34	760
QMW30508.1|GH3	2.71e-239	22	775	34	760
QMW42566.1|GH3	1.09e-238	22	775	34	760

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	6.94e-84	13	764	7	746	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.86e-83	13	764	7	746	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	9.31e-79	13	764	36	775	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	4.02e-77	1	764	1	742	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.04e-76	1	764	1	742	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KMH9|PLH34_FORAG	5.57e-80	13	763	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|T2KMH0|PLH24_FORAG	1.42e-76	98	775	60	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	1.95e-72	26	763	40	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	1.28e-70	26	763	40	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|A7LXU3|BGH3B_BACO1	7.82e-61	28	770	43	770	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS2430-t41_1-p1.