CAZyme Information: SAPIO_CDS2318-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS2318-t41_1-p1
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
868	JOWA01000086|CGC3	95319.48	5.2723

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000086:297014-300157(+)

Full Sequence      

MPLTRAFGEEPMTYGTDNTLHTLLGKLTLEEKVSLLSAVDWWRTPTIQRGGVFVPHIKTT
DGPNGARGGSYVSGIKAACFPCGTSLGASFDREQLYRTGKEIALEAKSKSANVLLAPTLN
VIRDPRGGRNYETYSEDPLVLGVLAAAFINGCQSEGIAATPKHYVANDTENKRTVLTVEI
DEQSLREIYMLPFQLGMKLSDPWCLMTSYNRINGTYVSDSDRLVNGVLRKEWGFKGLVIS
DWMGVYSTTESINAGVDVEMPGPTDWRADKLVQAVKDGLVSASTIDESALRVLQLASRLG
RFENPEEPPEQEAENEERDAFIRGAGAQGMVLLKNEGDVLPLSKGTSVAVIGHHATHASL
GGGGSARVDAIRSVSPAEGFREAGFTTTVAPGIPVYGALPHADATLLFDSATKTQCAQPV
QIEWFNGSRIGEGLVHKERKPLPEYMIKEKWPEYLSREYCSRITYDVRPTVSGEHVLSII
STGPAVCYVDNCEIYRQQQATDLRPESFYFFKSKIERRVRYRMEAGRQYTLVLESWNTDP
EILNAPPLCGKMFQGSALRFQEFVDAQQRIEEAVNAAKGADVAVVCVGTTSEIESEGFDR
ESIALTPGQADQVLAVAAANPRTVLVNFSGAPVDLSALVDKVPAIVQAWFPGQECGHSLV
LALGGDVGPAGRLPFSWPRREEDSSSWGNFPCDNENVIRYEEGLSVGYRYYDRPGSPAPL
FPFGFGLSYTTFELSGLHSTKDTFRWVHDRAAVAVDVHNVGQRLGSAVVQFYVEMPEEED
GVGSGKALGRGRPLKELKDFQKSHNILPGESRRITASLDKYAFSIYNAHEARWQVRPGMY
KVHAGFSSEDLRGFTNVTVPTTMFWDGV

Enzyme Prediction     

No EC number prediction in SAPIO_CDS2318-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	54	261	2.5e-61	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	7.93e-74	42	373	50	379	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.98e-72	80	852	120	758	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.35e-46	565	729	76	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.45e-44	69	295	76	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.42e-38	22	827	55	752	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95967.1|GH3	0.0	18	868	4	851
QKD60297.1|GH3	0.0	23	868	10	834
CEI61625.1|GH3	0.0	23	868	10	834
CEF77881.1|GH3	0.0	23	868	10	834
CZS81178.1|GH3	0.0	19	868	6	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.12e-154	23	868	9	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	7.45e-151	23	868	9	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.80e-112	23	863	8	672	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	3.40e-92	20	852	4	706	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.75e-91	20	852	4	706	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	2.14e-175	20	853	11	832	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	1.24e-169	23	860	5	811	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	1.92e-164	23	868	17	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	2.84e-160	23	868	17	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	3.69e-160	24	868	10	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000014

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS2318-t41_1-p1.