CAZyme Information: SAPIO_CDS2307-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS2307-t41_1-p1
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1228		136308.46	5.8420

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000086:256450-261858(-)

Full Sequence      

MSLKLPLIGLVASLLLGEAVGQTEEHPLLPTWKCTTSGGCVQQNTSVVLDRDSKFARGTA
GSRTAADYAAMGVSTSGDALTMHHYVKTDSGALNAASPRVYLLGEDGKYAMMKLLDQELS
VDVDLSALPCGENGAFYLSEMEPDGRGGAGAGNGYCDAQCQGYCCSEMDILESNSMATAM
TPHPCKGDNCDKAGCGYNPYASGQRDYWGPGKTVDTSKPFTAITQFSASGGRLSQVTRTY
IQNGRQIGGGGTISNCGSEGATGGLAGMGEALGRGMVLAMSIWNDPVQQMAWLDSGANGP
CGGGQGSPSNIQSQHPDTHVVFSNIRWGDIGSTTKAVQSLTDPSIGVPPESINMSGAEVL
GVISSIIAIVDGTKKLYDAASNAAGLPEAFREVAGRLPIVRDILRSAEQPIREGKLDAAS
CKAIKPLIARCEERAKMLDTIFQRVIPAEEASRLSRYVSAVKTLNKGGKVETLMKGLLDD
VLLLASRHGLESATVHQIDQTTKAIQDVSTIKPSIPDSEFQESLVTNNNFGNGPMTNNYV
LGNQKFQANYGTGKQFQAETQTFNMDLFYWRSHLTAAGVLDQLEFSGMNERYDDIAEAHK
QTFRWIYERRELKFVDWLKAGKGIYWITGKAGCGKSTLMKLLFEDNRTLESLPKDIENTS
LSSFFFHDRGQNPLLKSQEGLYRAILYSILSEYRQLIPITLPRRWEAMRRELKDLLTKDP
ITTKQIVDEILQKAEGVFLWVTLVVRSLVESLENGDDMKTLQKRLSVLPAGLEPLYRRMV
EQIDPFYHTHAAQIFRMVQSTAQPLSPLAMSFAEDNPRDALLEGGDIFSVKEIADRHSKV
AKRLKARTAGLTEISPLKRKSHGSNWLTNNKGDPPSESISRKIEQISWEPSRIQYLHLTV
KEFLRSDSVPTWLATQISQPDADAHLRIVACCLRQFRATGSFHLYDYSEINRYDSSDSMA
YCHATRDGIVFMIMFHALEVERITKASQLPYLEALDTLVMAHKPPCPDRISGYDEYGNEI
RESRQWHWTLDRYADWVEPREWLSDYVSYLITIGMTRSVIDKFNRGYNPASKPGRPLLHY
ATCSLAPGYAVTDFERDTLDPAMVEELLKRKTWTVWEAVLVEICARFSGDWANTEAMYDL
RLRWLKTIKLFLDYGADPAQFVIDDYNGPRGWERRYPEARVSALLILNRTFEDFDDPLVE
SIRNLMISKGATEVDEQDPQSDPRSGNL

Enzyme Prediction     

EC	3.2.1.4:18	3.2.1.73:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	67	334	2.1e-89	0.8120481927710843

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395677	Glyco_hydro_7	1.54e-128	22	333	5	434	Glycosyl hydrolase family 7.
153432	GH7_CBH_EG	1.41e-123	24	328	2	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
407249	SesA	4.37e-47	363	484	1	122	N-terminal domain on NACHT_NTPase and P-loop NTPases. This is a family of fungal N-terminal domains that appear at the N-terminus of P-loop NTPases, NACHT-NTPases and Ankyrin or WD repeat proteins. The exact function is not known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS45854.1|GH7	1.09e-190	1	335	1	335
AEO63146.1|GH7	6.67e-182	1	335	1	335
AUS45853.1|CBM1|GH7	2.33e-119	24	335	32	397
AEO67421.1|CBM1|GH7	1.15e-116	24	335	31	397
AEO58196.1|CBM1|GH7|3.2.1.4	1.74e-110	9	333	8	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EG1_A	5.93e-109	24	334	9	371	Chain A, ENDOGLUCANASE I [Trichoderma reesei],1EG1_C Chain C, ENDOGLUCANASE I [Trichoderma reesei]
5W0A_A	2.36e-104	24	334	9	371	Crystal structure of Trichoderma harzianum endoglucanase I [Trichoderma harzianum],5W0A_B Crystal structure of Trichoderma harzianum endoglucanase I [Trichoderma harzianum]
6SU8_A	9.22e-99	24	333	8	394	Chain A, Glucanase [Rasamsonia emersonii],6SU8_B Chain B, Glucanase [Rasamsonia emersonii],6SU8_C Chain C, Glucanase [Rasamsonia emersonii]
1GPI_A	2.29e-67	24	333	9	426	Chain A, EXOGLUCANASE I [Phanerodontia chrysosporium],1H46_X Chain X, EXOGLUCANASE I [Phanerodontia chrysosporium],1Z3T_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3V_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3W_A Chain A, cellulase [Phanerodontia chrysosporium]
1A39_A	4.50e-62	21	338	4	402	HUMICOLA INSOLENS ENDOCELLULASE EGI S37W, P39W DOUBLE-MUTANT [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QCS4|CEL7A_MYCTT	3.09e-111	9	333	8	395	Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=eg7A PE=1 SV=1
sp|A0A024SNB7|GUN1_HYPJR	1.93e-107	2	336	4	395	Endoglucanase EG-1 OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=egl1 PE=1 SV=1
sp|P07981|GUN1_HYPJE	1.93e-107	2	336	4	395	Endoglucanase EG-1 OS=Hypocrea jecorina OX=51453 GN=egl1 PE=1 SV=1
sp|Q12714|GUN1_TRILO	2.18e-106	24	336	31	395	Endoglucanase EG-1 OS=Trichoderma longibrachiatum OX=5548 GN=egl1 PE=3 SV=1
sp|A1CG87|CELB_ASPCL	1.01e-90	5	333	10	411	Probable endo-beta-1,4-glucanase celB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999760	CS pos: 21-22. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS2307-t41_1-p1.