CAZyme Information: SAPIO_CDS2290-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS2290-t41_1-p1
• CAZy Family: CBM87|CE18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310	JOWA01000086|CGC6	35752.95	4.3497

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000086:206863-207952(-)

Full Sequence      

MSVFFHYLNETGGYINYGPEGLDRFDRLVSRCEDLGLKLVLPLFNYWPDYGGAPLYIATY
SKTWTEQWIDLPKAQEVYRDYVKVIVERYKNSPAVFSWQLGNEPRCEGCGEEGMGRLVDW
ARNVSSYIKELDPDHMVSMGDEGWLTPREREEGYGDRGHGYDGINGVDWVSIMGIETLDY
GTVHLWPDHWAYPYEWGVQWIEDHDKLAAQFNKPIILEEYGAAKKNDHIEPLLPWQDALV
KSGFAADQTWQFEPDGTNFTDFPDPQFAIHYGSEEWLVLAQNHSLRIDAKTKALGIENGE
MVKLDFGQFI

Enzyme Prediction     

EC	3.2.1.78:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	16	252	2.1e-66	0.8546712802768166

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226444	COG3934	1.02e-25	13	224	58	248	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
395098	Cellulase	4.85e-06	11	222	47	238	Cellulase (glycosyl hydrolase family 5).
396834	Glyco_hydro_42	6.06e-04	77	131	107	168	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
225789	LacZ	8.30e-04	70	211	373	495	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
397119	Glyco_hydro_2_C	0.001	70	226	102	216	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD53723.2|GH5_7	3.67e-92	3	290	113	394
ATZ55503.1|GH5_7	3.67e-92	3	290	113	394
CCA94935.1|GH5_7	1.67e-90	2	287	114	393
APA12777.1|GH5_7	4.72e-90	3	284	113	388
QSZ30248.1|GH5_7	8.28e-89	3	284	113	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZIZ_A	4.07e-68	2	289	80	356	Chain A, Gh5 Endo-beta-1,4-mannanase [Podospora anserina]
1QNO_A	4.97e-66	2	283	69	339	Chain A, ENDO-1,4-B-D-MANNANASE [Trichoderma reesei],1QNP_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNQ_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNR_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNS_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei]
3WFL_A	8.91e-60	2	279	68	334	Crtstal structure of glycoside hydrolase family 5 beta-mannanase from Talaromyces trachyspermus [Talaromyces trachyspermus]
3WH9_A	2.71e-59	2	283	67	338	The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger],3WH9_B The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger]
3PZ9_A	9.56e-56	15	224	92	312	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B833|MANB_EMENI	5.50e-81	1	290	99	382	Mannan endo-1,4-beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manB PE=1 SV=2
sp|Q5AVP1|MAND_EMENI	3.65e-68	2	300	92	378	Mannan endo-1,4-beta-mannosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manD PE=3 SV=1
sp|B2B3C0|MANA_PODAN	1.64e-67	2	289	94	370	Mannan endo-1,4-beta-mannosidase A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=Pa_6_490 PE=1 SV=1
sp|B8NIV9|MANF_ASPFN	3.67e-65	2	283	184	456	Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=manF PE=3 SV=1
sp|Q2U2I3|MANF_ASPOR	7.26e-65	2	283	184	456	Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=manF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000001

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS2290-t41_1-p1.