CAZyme Information: SAPIO_CDS2251-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS2251-t41_1-p1
• CAZy Family: CBM87|CE18
• CAZyme Description: putative beta-glucosidase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
840		91755.83	4.7603

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000086:77258-80125(-)

Full Sequence      

MGNSGSQVSSYVAADYYPAPYGGWVGDWADSYARARELVESMTLAEKTNITSGTGIYMGM
NLVILVIHVASNELSSRLCLGDAANGVRLADFVTVFPAGITTGATWDKDLMYSRAVAMGK
EFRGKGVNIYLGPSVGPLGRKPKGGRNWEGFGADPVLQATGASLTIKGVQEQGVIATIKH
FIGNKQEMYRMYNPFQTGYSANIDDRTLHELYLWPFAEGVNNSACSQNSMLINGILKDEL
GFQGFVMSDWLAHMSGVGSALAGLDMNMPGDTQVPLFGYSYWMYDLTRSVLNGSVPVDRL
NDMATRIVAAWYRFGQDDGFPEPNFSTTTRDREGDLYAAAWPFSPRGVVNEFVDVQEDHY
LVARQVAQDAITLLKNDGPLLPLSTDRPIKVFGTGAAENSDGPNACSDRNCNKGTLGQGW
GSGTVDYPYLDSPIDALRKNAKDVTFYDTDKFPGVPTPGADDVAIVFITSDSGENTYTVE
GNHGDRDGSGLYAWHDGDALVKKAAETYANVIVVAQTVGPLVLERWIDMPSVKSVLFAHL
PGQEAGESLTNVLFGKVSPSGHLPYSITKQESDYPSSITDLVTGSGVQDDYVEGLYIDYR
YLNKAGIKPRYAFGHGLTYTNFSLTKPAITKVAKLSALPPTRPAKGNILDYSGPVPGESE
ALPPAGFNKIFRYIYSWLQPDEAKNAVKDRQTKTYDAYPRGYSTEQKPGPRSGGDEGGNP
ALWDVAYKISVTVTNSGAKHSGKEVVQAYVQFPDNIPYDTPITQLRDFAKTRELGPNESQ
VVELQLTRKDISVWDVEVQDWIIPNVDGRFKVWIGEASDRFSIVCYTDQLNCEANVEHPL

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	79	269	2.8e-46	0.9398148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	3.14e-48	371	599	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	5.13e-45	82	409	67	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.80e-32	94	820	118	756	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.47e-29	94	307	86	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.78e-19	33	649	51	664	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC82219.1|GH3	0.0	9	840	35	878
UKZ93663.1|GH3	0.0	6	840	44	892
QYS94687.1|GH3	0.0	11	840	52	895
ATY63588.1|GH3	0.0	8	840	34	884
BAP59015.1|GH3	0.0	11	840	51	895

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IIB_A	1.63e-198	16	823	9	833	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
6SZ6_A	2.47e-196	17	820	8	828	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJI_A	3.53e-195	16	823	9	836	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5FJJ_A	4.69e-195	16	823	10	834	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5NBS_A	7.17e-189	16	823	23	852	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y7Q8|BGLF_ASPFC	0.0	8	825	36	860	Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglF PE=3 SV=2
sp|Q4WMU3|BGLF_ASPFU	0.0	8	825	36	860	Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglF PE=3 SV=2
sp|Q2UN12|BGLF_ASPOR	0.0	16	825	40	857	Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglF PE=3 SV=1
sp|A1DMR8|BGLF_NEOFI	0.0	8	825	36	860	Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglF PE=3 SV=1
sp|B8NP65|BGLF_ASPFN	0.0	16	825	40	857	Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999633	0.000380

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS2251-t41_1-p1.