CAZyme Information: SAPIO_CDS2112-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS2112-t41_1-p1
• CAZy Family: CBM50|CBM50
• CAZyme Description: Alpha-L-rhamnosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
762	JOWA01000085|CGC2	84581.85	5.3390

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000085:321378-323859(+)

Full Sequence      

MRTFLYPPVSGPSPFLRLQIIIATVLFFIVLYLVFDPSSTWPPFGRRNPFVGEPTESVSW
HRYVRATQSDVIRPVAVLEKLTKGRVRNQHGLIDGTGPTVLVRKNETEEVPSIVVDFGMN
TVGILSIEFAHAKGDGESLPGLRLAFSETLKHLSSTSDFSRSYNACSQRFFESSDARDRS
VRKRKYTWTNQLGCEESGKVCADGLHGFRYVRISLDALKKDAPLTTPQGTVAISSISIRL
SAFHGTPDTFTGMFECSDEDLTQWWYDGVYTNDLCTDTFRANDTEPRDADSDSLDGKLVL
HDGAKRDRDPYVGDLAVAALTTYLSHDTSEAVRNVLADLADHQRDDGWIPPASIFRYTLH
LFDYPLWWVVCTFDYVMHTGDMKYLRQYYPNMVAVLDGFYPSLMNNETGLVEKGRRGTGG
WGDYAFIRRTGPVTYYNALYVYALRLASVLAESLSATSNDTRSHDAQRWMLRADSVSTAL
KEHNFDHTEGLFYDGTCSRGKVYCPTHAQDGNSIAILAGVVSQETGGDPALPTAQSILHR
WGNITARDWGNAYYSNSFLAGDYGDRTYAFISYFEIAARFETGLVDSALEEMRRLWGYMA
SRDPGVTFWEGSDPSYNRDSFKSMAHGWSSGVVALLTRYVLGVTPEGPGFTKWKVKPREG
DLSWARGVVPVPGSKEGIRVAWSRAESGSFSLEVKVPEGLDGGIIAVPVISRPVDVRVNN
EVVWGDGVVGQVSAKLVDGYVEFEAQGSEFSIVVDPAEGGEL

Enzyme Prediction     

No EC number prediction in SAPIO_CDS2112-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	112	702	8.7e-90	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	3.18e-20	251	640	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	8.87e-08	642	699	1	56	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225942	GDB1	4.28e-07	333	494	306	469	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
283786	GDE_C	5.79e-06	363	452	84	184	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
407295	Glyco_hydro_36	0.004	363	526	126	292	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC77143.1|GH78	5.18e-245	56	744	56	758
QBZ59627.1|GH78	1.74e-242	59	757	40	732
UKZ97108.1|GH78	4.33e-235	59	755	29	711
QYT03284.1|GH78	2.55e-234	52	755	22	712
ATZ46524.1|GH78	6.16e-234	22	727	13	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	6.00e-17	207	701	504	936	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.82e-09	104	641	86	543	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

SAPIO_CDS2112-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000003

TMHMM  Annotations     

Start	End
13	35