CAZyme Information: SAPIO_CDS1909-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS1909-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: Beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841		91368.10	5.7553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000077:941673-944324(+)

Full Sequence      

MRATVDTEAILRSLTLEEKISLLAGGSFWETVAIPEKGIPSIKTTDGPNGTRGEDFDGNT
SAACFPAASSIAASFDPEIARAVGFALAQEARSKGASCLLAPTVCIHRHPLGGRNFESYS
EDPLLTGKLASSMIRGVQSLGVAATIKHFVANEQETDRMTVDETIGERALREIYLRPFEI
AVKEAGPWALMSAYNKVNGEHCDGNEWLLSKVLREEWGWEGMVMSDWGGTNSLAGIKAGL
ELEMPGPAVVRKLDVVVAAVKRGEVQEEDIDKRVRTLLRFLVNLNAFENSGSPMREKAID
RPEHRKLIRDAGARGIVLLKNDNDILPLSLSKLKAKKVALIGFAKDALAHGGGSAAVNAH
YKITPWDAFQNSFGNDVEFTYAKGAHRERLLAPLGKNDRRGTVIGLDDQPGFTLSFYDPS
NPTSPLATKHGHEKSGYSPLGTQESLQKILELVGDFSPAETGNHCLAGSGLGETEVFIDD
ELVIKQEGNFSDPMGVLFNAQTEAEIRHTFTAGKTYRLRIRSYPPSNVGLKILEGRTGFR
LGLSLASEHDADLQGEAVKVAQEADYAIVFTGHDPQWETEGRDQDSFHLPRQGSQDALVS
AVAAVNSNTIVVNSTGVAVAMPWLDQVAGLLQTWFPGQECGNSIVDVLTGSVNPEGHLPT
TFPRRIEDAPAYGNFPGTYDGNKQRKVTYAEGVFIGYRHYDRLSKDKVNFPFGFGLSYTS
FCLGEMKVSRGYEDTFTVTYKVSNTGNTAGGVAVQVYAGKTQQSPEHPIKSLVAFQKVRL
PAGADQMGLMVFKAKDFAYFDEARHAWVVEAGKYDISLGKSAADIAQVVSVQVEREIVYA
P

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	1.7e-65	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.60e-76	65	827	120	759	beta-glucosidase BglX.
224389	BglX	1.69e-73	26	342	47	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.56e-50	316	697	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.95e-47	9	833	55	779	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.26e-42	38	279	65	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC73924.1|GH3	0.0	1	837	26	864
UPK95449.1|GH3	0.0	1	835	1	833
QGI87315.1|GH3	0.0	3	837	2	834
QGJ00832.1|GH3	0.0	3	837	2	834
CCT74517.1|GH3	0.0	3	837	2	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.68e-170	6	837	5	840	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.48e-166	6	837	5	840	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.44e-131	5	837	3	672	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.14e-123	6	836	4	666	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.96e-122	10	825	7	705	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	7.14e-314	8	836	12	841	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	6.60e-191	10	841	5	818	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	3.11e-175	5	816	4	814	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	6.00e-175	5	816	4	813	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	4.85e-174	5	816	4	814	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999276	0.000752

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS1909-t41_1-p1.