CAZyme Information: SAPIO_CDS1899-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS1899-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	JOWA01000077|CGC6	45266.96	4.1878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000077:907878-909280(+)

Full Sequence      

MRPSIISLFLAAGATALPRRPCKRPGQGQNLSAFSAHRGEVDVPEVEVTRARPSVSKGAR
PQTSPEVSIPKTSPSQTPATNDEPESDVSAPAPSAPVATVPEESTSEESAPAAPVEAPAS
GGTSSVSGLPSSWKPGAKWQIVIDDPVDITKPLNPPDAQVWVVDYFHSVENPDIIPKLKS
PSAGVDNTVICYINLGAIQESESDYPSFPKDAIGNDYDGYPEWWIDTSRSDVIDFMKKRL
AKAAEVGCDGIDGDNIDGWDSGSAGDKTGFALTKAESINYIRTLATYAHSLKTQRGLPLL
FGQKNSQQLIPDVADYVDFAVLEDCQGSGDWCGEFQGFITGAARSDGAKLPVFDIEYPDS
GVDGDASIAQSDWDHYCNRDPAVVGNAGFSTIIKRTSGELDGWVQYCEDSASAGVYTTNM
IQWN

Enzyme Prediction     

No EC number prediction in SAPIO_CDS1899-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	139	357	5.8e-42	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	3.23e-60	138	402	1	221	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	5.52e-07	188	326	104	243	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
273167	rad23	7.13e-04	54	149	75	166	UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
236090	PRK07764	0.004	11	98	415	502	DNA polymerase III subunits gamma and tau; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK97753.1|GH114	9.07e-62	131	407	33	305
QKD47958.1|GH114	1.71e-58	131	407	35	307
QGI89288.1|GH114	5.27e-58	131	407	51	323
QGI58377.1|GH114	5.27e-58	131	407	51	323
CCT61950.1|GH114	5.27e-58	131	407	51	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	1.35e-30	131	407	32	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	1.96e-30	131	407	49	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

SAPIO_CDS1899-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.177636	0.822336	CS pos: 16-17. Pr: 0.7785

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS1899-t41_1-p1.