CAZyme Information: SAPIO_CDS1654-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS1654-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528	JOWA01000066|CGC4	59565.97	4.9448

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000066:792870-794847(+)

Full Sequence      

MKFLSLSLTGAALVSGASLKEARPNGKTPRAPSCRFGLQWSQQDVLERTDDFIWDLLYWE
GKFHQNDVAYNAENGMSYDGTQLDWETGERTRKHDFSAASKEALQIMLYAQAIAGSEEAA
RFLTPGNLSSAPAFAASIMETKLKSYQQFNQTYPGFGGYLPWIKTNEAQVTVADGWNDRV
PGLDNGELVWAVYACIEALQRHFAPNFQKLATGWQEWLDYVASTAAEIFYIGKGRVCAVT
AIGDQSLPVWHSNQTYDCESEFYLDDPYEGETFTYFLEFFGKMPKKDKHKLWEYKRAKLE
KAEYNQGGIGPITVRKGYWFSSHEIWNQMELPYYDVDIVRRLFLNGERARTCNSVVTKSP
GLYASVNNSTDPETDTIIGYISPAGIPSIASQKDQYHDVVTPYGAYPVVLFDKAVGLAWW
RNMVIGKKMQNPYGSTESTQIDGKLVSALVTWDSKVTTVVALLGGVTDLVRDRMRSDGIY
ERFVEITKREHVRVFGHHLKGEDIDLCLPEEQVPDAGLEDFTSCEAQF

Enzyme Prediction     

EC	3.2.1.71:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH162	33	524	3.5e-207	0.9958677685950413

CDD Domains     

SAPIO_CDS1654-t41_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK99704.1|GH162	0.0	2	526	7	528
QPC64695.1|GH162	2.08e-312	1	525	1	522
QPC73588.1|GH162	4.20e-312	1	525	1	522
CZS73213.1|GH162	1.40e-310	1	525	1	522
SCB65247.1|GH162	1.99e-310	1	525	1	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IMU_A	4.39e-233	32	524	13	504	The apo-structure of endo-beta-1,2-glucanase from Talaromyces funiculosus [Talaromyces funiculosus],6IMU_B The apo-structure of endo-beta-1,2-glucanase from Talaromyces funiculosus [Talaromyces funiculosus],6IMV_A The complex structure of endo-beta-1,2-glucanase from Talaromyces funiculosus with sophorose [Talaromyces funiculosus],6IMV_B The complex structure of endo-beta-1,2-glucanase from Talaromyces funiculosus with sophorose [Talaromyces funiculosus]
6IMW_A	1.25e-232	32	524	13	504	The complex structure of endo-beta-1,2-glucanase mutant (E262Q) from Talaromyces funiculosus with beta-1,2-glucan [Talaromyces funiculosus],6IMW_B The complex structure of endo-beta-1,2-glucanase mutant (E262Q) from Talaromyces funiculosus with beta-1,2-glucan [Talaromyces funiculosus]

Swiss-Prot Hits     

SAPIO_CDS1654-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000769	0.999209	CS pos: 16-17. Pr: 0.9387

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS1654-t41_1-p1.