CAZyme Information: SAPIO_CDS1300-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS1300-t41_1-p1
• CAZy Family: AA8
• CAZyme Description: putative beta-mannosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	JOWA01000055|CGC1	97660.13	5.1219

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000055:309857-312518(+)

Full Sequence      

MARRSITPLDKGWHFKQVDKDSSEYLPVAQFPTNIHLDLIHHNLIPDPFIGKNELQVQWV
GEAVWSYRTHFASPADAPQGAKAVIAFDGLDTFATVKLNGEVILETENMFLPERVDVTGK
LKTDGENELEITFDSAYLRGCKLVDKYPEHKWGCWNGDVSRLAVRKAQYHWGWDWGPTLL
TCGPWRPINLEVYDSRIEDLFFETDVDPTTKTVKVTTIARTEGPASKVRFDISLDGTPVS
SQTINAAAGADTKTEFTITNAKLWYPIRYGDQTLYTITATLLASSDEIEVDTVSKKTGFR
KAELVQQPLEEQPGTSFFFRVNGIPVFCGGSDWIPADNFVPRITRETYRNWIRLLADGNQ
FMIRVWGGGIYEEAAFYEACDEFGILVWQDFMFGCGNYPAWPELLKSIEREAVANVKALR
HHPSIVIWAGNNEDYQYQESENLTYDFDNKDAESWLKTDFPARYIYEKVLDDVCREHIPG
TFYHYGSPWGGKDTRDPTVGDIHQWNVWHGTQEKYQNFDTLVGRFVSEFGMQAFPSVKTI
DQYLPLGRDDPDRYPQSSTVDFHNKAEGHERRIALYLVENMRYAPDPLEHFVYCTQLMQA
ECLASAYRLWKRQWKGPNREYCGGALVWQINDCWPVTSWSMCDYYLRPKHAYYTVKREMA
PLSIGITRREHRHPRDKHTRVHIDTKTRVEIWGSNLALEDVTVDCVVKAWDVETAERTFS
QTVRGSLLLPANRSTEIAALDVPVRNPGDEARTVVAAYLYRGEEKLARYVNWPEPLKYLH
LRKPEALKAVLVDGGERVEVSAEVPVKGVALECEDDGVVFGDNLVDVVPGEVVSIPVRGA
TEETVLTTRYLSMLN

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	747	3.7e-99	0.7034574468085106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	8.19e-77	4	656	10	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	8.36e-14	687	778	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	4.65e-11	196	300	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	1.41e-09	67	435	113	452	cryptic beta-D-galactosidase subunit alpha; Reviewed
397119	Glyco_hydro_2_C	5.19e-04	376	495	64	203	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC87618.1|GH2	0.0	1	855	26	877
AEO69937.1|GH2	0.0	1	854	1	851
AFJ59925.1|GH2|3.2.1.25	0.0	1	854	1	855
AEO53082.1|GH2	0.0	1	854	1	855
VBB71464.1|GH2	0.0	6	854	8	854

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.29e-141	1	666	21	660	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	7.41e-121	9	831	11	810	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	7.78e-121	9	831	13	812	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	7.97e-121	9	831	13	812	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.08e-120	9	831	11	810	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	0.0	1	854	1	855	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q0CCA0|MANBB_ASPTN	5.70e-296	9	839	9	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|A1CGA8|MANBB_ASPCL	8.02e-294	1	839	1	830	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	3.23e-293	1	839	1	830	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	3.23e-293	1	839	1	830	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS1300-t41_1-p1.