CAZyme Information: SAPIO_CDS1077-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS1077-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1115		125094.42	3.5425

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000044:836002-839552(-)

Full Sequence      

MVFLLYASLLVVGAIVPSANALRVSTSEDGSSSLVFRNGAFSVANTIYTGSAAGDKALLA
ASADEHRRRVSSTVRYTEISPGVVQVDIVPLQVPGDELAPDDPIEVDPPVVDVPDGGEEQ
DPDEQVPDEEDPEEGDGENEEVIVEDPEPEPEPEPEPEPQPEEPEPEPEPEPEPEPEPEP
QPEPEPEPEPEPQPEPEPEPEPEPQQPEPEPQPQPEPEPEEPEPAPEPEPEPEPEPEPEP
EPEPEVPEPEPEEPQPEPEPEPEPDVPEPEPEPEPEPEPEPQPEPEPEPEPEPQQPEPEE
PEPEPQPEPEPEPEPEPQQPEPEPQPQPEPEPEEPEEPEPAPEPEPEPEPEPEPEPEPEP
EVPEPEPEPEPEPEEPEPQPEPEPEPEPEPQEPQPQPEPEPEPQPEPEPQPEPEPEPEPE
PEPQEPEPQPEPEPEPQPEPEPEPEPELQPQPQPEPEEPFTGIITTSSFTFESNDTIYGV
WEYPFNGSIANHDITFPVKGLFGSQPGINYANARAPFFFTRSGFGVYVDTLAMGTFAFEG
STASFSFAAEEEVSYKVLFNPDLKALLREYAELSSKPELPPDSGYGPVFWSDNILRDFHG
SVENAEENLYDVVDHLYYNEIRATAMFADRPYGTGNMSFGNFDFDPEFFPDPEAFIANIT
EWGYDFQVWVANRAFLDTELYTTALENGWLFPGINGEEFLGPALDLTIPEAYEYFQERLR
YFADIGVKGFKIDRGEEHELPDELQNLHNTIFQQLCHEVMVDKWGAGNFFSFSRSVVDRA
RSLTAVWNGDSQADWEGLAFSVASGIRAGLLLFSTWGSDIGGYTRPDETTPSEELWARWM
QFGAFSPHYVSYYPIYLRDFTVMEVFLTLAILQEIMVGDGHTPWYEPYSSELLDVLKKTA
DWHTRLIPYIRSYTYQSTQTGIPVIRALFLEYPVDGTIYETGDAYAFGAEFFVAPFIAEG
GVRTVYFPDAGENSASRKFVDWFNKTAIYHGGTEIEVALPLDEFPVYVREGSIVPTGDIY
QGNAKWIEDWKPTLEIEFYPSYAVEESRFEYLRADGEIAVITMRTNREAETVLVQTDALG
VEGVFKVYSKTGAAEIPFTPDSMSFLMDKVATLFD

Enzyme Prediction     

No EC number prediction in SAPIO_CDS1077-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	557	1014	1.7e-79	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224418	YicI	7.68e-77	465	1092	143	742	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	9.84e-71	557	1014	2	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	1.24e-43	639	969	47	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
269879	GH31_xylosidase_YicI	8.30e-38	576	848	2	276	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
236691	PRK10426	2.78e-37	512	1013	136	622	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO21215.1|GH31	4.15e-216	467	1115	107	726
QRN85306.1|GH31	5.71e-51	499	1040	118	632
QAY33732.1|GH31	5.76e-50	507	1014	188	676
QTB90139.1|GH31	1.88e-49	474	1012	158	674
QSY58177.1|GH31	1.88e-49	474	1012	158	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7C_A	1.40e-42	466	1015	193	716	Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6JR6_A	1.71e-36	516	1057	197	728	Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
2F2H_A	2.97e-36	475	1074	160	725	Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	3.04e-36	475	1074	160	725	Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
6JR8_A	1.60e-35	516	1057	197	728	Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AW25|AGDD_EMENI	3.65e-45	503	1015	205	697	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
sp|P31434|XYLS_ECOLI	1.52e-35	475	1074	160	725	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|Q9F234|AGL2_BACTQ	1.82e-32	516	1019	189	679	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|P96793|XYLQ_LACPE	3.80e-32	474	1063	157	732	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
sp|P32138|SQASE_ECOLI	4.28e-26	571	1012	241	666	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999719	CS pos: 21-22. Pr: 0.9775

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS1077-t41_1-p1.