CAZyme Information: SAPIO_CDS10447-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS10447-t41_1-p1
• CAZy Family: AA4
• CAZyme Description: Beta-1, 3 exoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1045		108311.61	4.3085

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000165:1010248-1013546(+)

Full Sequence      

MRSKLSSLLYLSALAVTAAADPTWPNAIDDLEEIMYQVFDFRARKFADLVHPCDNQGSGA
GRQNAAEWLRTGFHDMSTANTFFGTGGLDGSLQYELTNGENAGPGFGRTLSFMAPYFSKK
TSVADLIALGVYTSVRACDGPVIPVRHGRVDATRKGSTGVPQVGNSVLTFKQQFSRMGFD
EFEMIQLVACGHSLGGVHSTEFPALVPSGQFPNDRAPLDSTPASYDNHIVTEYLDDSTDN
PLIKGPSVGLGHNSDFKVFSSDGNATMQAMADNTVFQSTCQNVLGRMIDVVPKNVVLTNP
VQPYMVKPVNLQLLLNAGGATTLQWTGYIRVRTTELPLADIQSLTITYKDRNGGSNCGSS
TCSRTLTVSGIGRGFDDSFAFFPINTAIPASSGISSFTITINKKNGDQLPFDNNGNAYPM
QDAVVLQKQQTCLLQTSGAFTLTAAVRNDVADQAVSAKIAYKTTRDTSPVPLLQEMTLAL
SKGDCYGGYTFFSGSTTIPGALSFESTVDISAGEYTEAFRRVDEIGGSCREFTGVATCSS
ANPSSSLSSSSLVASTSSETSAVPTSDSTSADSSTSVTANPSSSSSSSPSSTSVALTSSE
ASAVPTSDTTSGDPSTASSTSSSTSPSTSSDDSSSTPSSASSSTSGFSSASSSVSSTSSS
EPSSTSSSTPSSTSSSDSTSISSSASSSSTSSSTSSSTSASPSFSTSDFSSASSSTSSST
PSSDSSSPSATPTQTLPHHRPTIGGYTLLSCWTEGANNIRALKEASFASDAMTLESCMAF
CAGYVYWGTEYGRECFCGDSLDATSSEAPLSECDMVCSGDDSQYCGAGNRLELYSTTATG
VPTATPTPDDHFPSPIGPYNLVGCWKEGANGVRALDAKATASPDMTLDKCAEFCDGFCGN
TLHQTSSPAPISNCNTPCPGNATQHCGAANRLTLYQLPDYQEPHHPSPIGPYTFAGCRTE
LGPGARALSSAAFADDGMTNGMCAGLCEGYAFFGTEYARECFCGNELAEGSEVADVGDCA
MVCAGDGGELCGGPNRLSVYSLGAV

Enzyme Prediction     

No EC number prediction in SAPIO_CDS10447-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	61	243	1.9e-25	0.6941176470588235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	8.17e-118	24	289	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
396406	WSC	2.29e-23	751	827	3	80	WSC domain. This domain may be involved in carbohydrate binding.
396406	WSC	1.06e-20	956	1033	2	80	WSC domain. This domain may be involved in carbohydrate binding.
173823	plant_peroxidase_like	7.87e-20	62	288	15	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	8.82e-16	60	198	11	155	Peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB76056.1|AA0	1.85e-274	9	1040	14	928
QBZ57066.1|AA0	1.48e-232	2	1040	4	799
QGA18666.1|AA5_1	6.58e-145	12	1040	13	924
QRV94524.1|AA2	9.69e-99	9	532	7	535
QRW22025.1|AA2	2.07e-97	5	532	2	538

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FWW_B	9.99e-09	749	836	91	180	Wnt modulator Kremen in complex with DKK1 (CRD2) and LRP6 (PE3PE4) [Homo sapiens]
7BZT_E	1.67e-08	749	836	100	189	Chain E, KRM1 [Homo sapiens],7BZU_E Chain E, KRM1 [Homo sapiens]
6SNW_E	1.69e-08	749	836	103	192	Chain E, Kremen protein 1 [Homo sapiens]
5FWS_A	1.88e-08	749	836	131	220	Wnt modulator Kremen crystal form I at 1.90A [Homo sapiens],5FWT_A Wnt modulator Kremen crystal form I at 2.10A [Homo sapiens],5FWU_A Wnt modulator Kremen crystal form II at 2.8A [Homo sapiens],5FWV_A Wnt modulator Kremen crystal form III at 3.2A [Homo sapiens]
1IYN_A	1.83e-07	69	195	29	166	Crystal structure of chloroplastic ascorbate peroxidase from tobacco plants and structural insights for its instability [Nicotiana tabacum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	5.85e-135	20	935	19	715	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|P84675|PFM_CHAGB	5.76e-34	885	1040	43	219	Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=CHGG_05463 PE=1 SV=2
sp|D4AUF1|WSCD1_ARTBC	6.41e-28	746	1040	63	401	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|A2BGL3|WSCD2_DANRE	2.63e-14	749	936	138	329	WSC domain-containing protein 2 OS=Danio rerio OX=7955 GN=wscd2 PE=3 SV=1
sp|Q2TBF2|WSCD2_HUMAN	2.37e-13	749	936	131	322	WSC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=WSCD2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000277	0.999706	CS pos: 20-21. Pr: 0.9441

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS10447-t41_1-p1.