CAZyme Information: SAPIO_CDS10354-t41_1-p1

Basic Information

• Species: Scedosporium apiospermum
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Scedosporium; Scedosporium apiospermum
• CAZyme ID: SAPIO_CDS10354-t41_1-p1
• CAZy Family: AA4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1000	JOWA01000165|CGC6	110813.16	5.0906

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SapiospermumIHEM14462	10920	N/A	2544	8376

• Gene Location: location=JOWA01000165:629186-632476(+)

Full Sequence      

MGRFLLLLTALLLAPVYVRAQAVFAHFMVGNTETLSQGDWENNMRLAQEAHIDAFALNMA
YDWPHNRRSVSRAFAAARARNFKLFFSFDYAGNGPWDVNEVLFFLNTYGRDSAHWQHQGR
PFASTFEGPDQADDWIDIKAQTGCFFVPDWSSMGAGPAMQLGGGVADGLFSWAAWPYGVS
DMTTYVDASYLQALNGKPYMMPVSPWFFTNLPGYNKNWLWNGDDLWYHRWQHVWSVRPEW
VQIISWNDFGESHHIGPLDDRQYEAFDVGRAPFNYVVNKPHDGWRVHLPYVIDTYKNLRP
AIGRESVVSWFRQTPGRACDSGGTTGNTASQLQIELDPASVLGDRVFVTALLDRPAQLRV
GGWIINEWDHEPREGIGLYHHSIPFNESIGLESGVSVSLWRNNAPFLTVNSGAAVSSACP
DSVMNWNPIVISGQSSSTSNVRASLSLSEQACVEGTGTDNGGFRQLCEFTCKYGYCPVSA
CTCTLMGPRETPPPLDPGVSKPGYPANGDANYGGLCSFACNWGFCPEAQCSTSPQPPFIP
LQSPFAFPACISGRGQGDGRWDGLCDYGCHFGFCPMHRCQCVATGHLIVPPTPNGPGFSS
TGEEDYGLCAFACGRGYCPTGCADAQWPILRAGGPPDTRFLAFGDSYSTGVGAGDPLGSQ
FDPQNRCMNSVNSYPRYLRRALDGLPTFESSDISHVGCTGAISRDISVPDKDGRTAQIDL
VANNGDLNLAGWATLSIGGNDCGFGNVAESCLFVYSESGCREAIRQARDELIPDLRRKIL
ATYLDILTGALNKRFLLIVTGYPKFFNENPANCRNGDSWQWFYPWGGLLSDDRRIEINAL
VGEANRRIEETVQEVRERLSRTGNRQIKFFPVDHLYEGHRFCEDSPADWQEESWFHHIMS
YDKLPAGNLIPPGGGPPMDLREHARTCSQIQYDQDEWAERILCRIAVDVSNGTLEDPLLP
GPLDVWHVIKAMHPRSIGNNAVGQAIFEYLKTLPQVDGWQ

Enzyme Prediction     

EC	3.2.1.59:2	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	23	404	2e-136	0.9813333333333333
CBM24	451	530	1e-22	0.9868421052631579
CBM24	549	621	1.8e-18	0.9605263157894737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	5.63e-162	23	404	1	368	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	3.11e-123	18	297	2	282	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	9.99e-40	23	292	1	283	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
238861	SEST_like	1.04e-31	639	895	2	234	SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
211416	GH99_GH71_like_3	8.55e-06	98	257	142	309	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT03219.1|CBM24|GH71	3.07e-228	8	622	10	632
UQC78235.1|CBM24|GH18|GH71	8.56e-176	19	556	20	556
BCS05636.1|CBM24|GH71	2.28e-169	28	509	1	473
CAP83026.1|CBM24|GH71	1.28e-167	20	555	21	552
UQC77500.1|CBM24|GH71	2.38e-162	17	556	16	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MAL_A	3.39e-13	638	912	2	217	Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus],5MAL_B Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus]
4HYQ_A	1.05e-10	640	898	5	208	Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297 [Streptomyces albidoflavus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6GX22|MU71A_PENRW	1.76e-52	23	445	38	445	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O13716|AGN1_SCHPO	7.24e-43	23	360	24	359	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|O94510|AGN2_SCHPO	1.72e-23	21	296	11	298	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2
sp|Q9S2A5|LIP1_STRCO	2.22e-12	608	907	10	255	Lipase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO1725 PE=1 SV=1
sp|Q93MW7|LIP_STRRM	2.99e-12	638	912	36	251	Lipase OS=Streptomyces rimosus OX=1927 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000211	0.999777	CS pos: 20-21. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in SAPIO_CDS10354-t41_1-p1.